SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|117320513|ref|NP_653289.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117320513|ref|NP_653289.3|
Domain Number 1 Region: 33-111
Classification Level Classification E-value
Superfamily EF-hand 0.0000866
Family Calmodulin-like 0.011
Further Details:      
 
Weak hits

Sequence:  gi|117320513|ref|NP_653289.3|
Domain Number - Region: 251-296
Classification Level Classification E-value
Superfamily XRCC4, C-terminal oligomerization domain 0.0445
Family XRCC4, C-terminal oligomerization domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|117320513|ref|NP_653289.3|
Sequence length 562
Comment coiled-coil domain-containing protein 155 [Homo sapiens]
Sequence
MDLPEGPVGGPTAEMYLRERPEEARLGMPVSLEEQILNSTFEACDPQRTGTVAVAQVLAY
LEAVTGQGPQDARLQTLANSLDPNGEGPKATVDLDTFLVVMRDWIAACQLHGGLELEEET
AFQGALTSRQLPSGCPEAEEPANLESFGGEDPRPELQATADLLSSLEDLELSNRRLVGEN
AKLQRSMETAEEGSARLGEEILALRKQLHSTQQALQFAKAMDEELEDLKTLARSLEEQNR
SLLAQARQAEKEQQHLVAEMETLQEENGKLLAERDGVKKRSQELAMEKDTLKRQLFECEH
LICQRDTILSERTRDVESLAQTLEEYRVTTQELRLEISRLEEQLSQTYEGPDELPEGAQL
RRVGWTELLPPSLGLEIEAIRQKQEVATADLSNPLCGVWQWEEVIHETSEETEFPSEAPA
GGQRNFQGEPAHPEEGRKEPSMWLTRREEEEDAESQVTADLPVPLGAPRPGDIPENPPER
PARRELQQALVPVMKKLVPVRRRAWGQLCLPPQRLRVTRHPLIPAPVLGLLLLLLLSVLL
LGPSPPPTWPHLQLCYLQPPPV
Download sequence
Identical sequences Q8N6L0
gi|117320513|ref|NP_653289.3| ENSP00000404220 ENSP00000404220 9606.ENSP00000404220 ENSP00000404220 NP_653289.3.87134 NP_653289.3.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]