SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|117320537|ref|NP_002652.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117320537|ref|NP_002652.2|
Domain Number 1 Region: 312-478,869-1045
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.44e-123
Family Mammalian PLC 0.00000678
Further Details:      
 
Domain Number 2 Region: 621-736
Classification Level Classification E-value
Superfamily SH2 domain 4.98e-31
Family SH2 domain 0.0000208
Further Details:      
 
Domain Number 3 Region: 528-640
Classification Level Classification E-value
Superfamily SH2 domain 1.27e-25
Family SH2 domain 0.00051
Further Details:      
 
Domain Number 4 Region: 1062-1183
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.14e-23
Family PLC-like (P variant) 0.0033
Further Details:      
 
Domain Number 5 Region: 15-130
Classification Level Classification E-value
Superfamily PH domain-like 2.63e-20
Family Pleckstrin-homology domain (PH domain) 0.0062
Further Details:      
 
Domain Number 6 Region: 766-829
Classification Level Classification E-value
Superfamily SH3-domain 1.06e-18
Family SH3-domain 0.00022
Further Details:      
 
Domain Number 7 Region: 160-309
Classification Level Classification E-value
Superfamily EF-hand 0.0000000031
Family Calbindin D9K 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|117320537|ref|NP_002652.2|
Sequence length 1265
Comment 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2 [Homo sapiens]
Sequence
MSTTVNVDSLAEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADK
IEGFLDIMEIKEIRPGKNSKDFERAKAVRQKEDCCFTILYGTQFVLSTLSLAADSKEDAV
NWLSGLKILHQEAMNASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLINFKVSSA
KFLKDKFVEIGAHKDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASA
VYLHDFQRFLIHEQQEHWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENS
IWDEKYDAVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSPEAYIRCLRMGCRCIELDC
WDGPDGKPVIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCSVEQQRHMAKA
FKEVFGDLLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNMEDKKDEHKQQGE
LYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTMEEEVPQDIPPTELHFGEKWFHKKVEKR
TSAEKLLQEYCMETGGKDGTFLVRESETFPNDYTLSFWRSGRVQHCRIRSTMEGGTLKYY
LTDNLTFSSIYALIQHYRETHLRCAEFELRLTDPVPNPNPHESKPWYYDSLSRGEAEDML
MRIPRDGAFLIRKREGSDSYAITFRARGKVKHCRINRDGRHFVLGTSAYFESLVELVSYY
EKHSLYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDY
KAKRSDELSFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISTADFEELEKQII
EDNPLGSLCRGILDLNTYNVVKAPQGKNQKSFVFILEPKQQGDPPVEFATDRVEELFEWF
QSIREITWKIDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVE
TKADSIIRQKPVDLLKYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTADKY
MQMNHALFSLNGRTGYVLQPESMRTEKYDPMPPESQRKILMTLTVKVLGARHLPKLGRSI
ACPFVEVEICGAEYDNNKFKTTVVNDNGLSPIWAPTQEKVTFEIYDPNLAFLRFVVYEED
MFSDPNFLAHATYPIKAVKSGFRSVPLKNGYSEDIELASLLVFCEMRPVLESEEELYSSC
RQLRRRQEELNNQLFLYDTHQNLRNANRDALVKEFSVNENQLQLYQEKCNKRLREKRVSN
SKFYS
Download sequence
Identical sequences P16885
gi|117320537|ref|NP_002652.2| ENSP00000482457 HR6338 ENSP00000352336 NP_002652.2.87134 NP_002652.2.92137 9606.ENSP00000352336 ENSP00000352336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]