SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|117676365|ref|NP_055165.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|117676365|ref|NP_055165.2|
Domain Number - Region: 139-175
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0667
Family Calponin-homology domain, CH-domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|117676365|ref|NP_055165.2|
Sequence length 198
Comment tumor necrosis factor alpha-induced protein 8 isoform a [Homo sapiens]
Sequence
MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTRE
YTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVD
YTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKP
HLQKLCDGINKMLDEENI
Download sequence
Identical sequences A0A2I2ZF89 H2QRD4 O95379
ENSGGOP00000002931 ENSPTRP00000029368 GO.35268 gi|117676365|ref|NP_055165.2| ENSGGOP00000002931 ENSP00000421848 ENSP00000422245 NP_001273742.1.87134 NP_001273742.1.92137 NP_055165.2.87134 NP_055165.2.92137 XP_001152429.1.37143 XP_003826759.1.60992 XP_004042439.1.27298 9606.ENSP00000408534 ENSPTRP00000029368 ENSP00000421848 ENSP00000422245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]