SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|117956371|ref|NP_001071154.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117956371|ref|NP_001071154.1|
Domain Number 1 Region: 444-556
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.44e-37
Family Pyk2-associated protein beta ARF-GAP domain 0.00053
Further Details:      
 
Domain Number 2 Region: 260-321,384-429
Classification Level Classification E-value
Superfamily PH domain-like 8.52e-20
Family Pleckstrin-homology domain (PH domain) 0.009
Further Details:      
 
Domain Number 3 Region: 568-658
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.02e-16
Family Ankyrin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|117956371|ref|NP_001071154.1|
Sequence length 663
Comment arf-GAP with GTPase, ANK repeat and PH domain-containing protein 8 [Homo sapiens]
Sequence
MGNILTCRVHPSVSLEFDQQQGSVCPSESEIYEAGAGDRMAGAPMAAAVQPAEVTVEVGE
DLHMHHVRDREMPEALEFNPSANPEASTIFQRNSQTDVVEIRRSNCTNHVSTVRFSQQYS
LCSTIFLDDSTAIQHYLTMTIISVTLEIPHHITQRDADRSLSIPDEQLHSFAVSTVHIMK
KRNGGGSLNNYSSSIPSTPSTSQEDPQFSVPPTANTPTPVCKRSMRWSNLFTSEKGSDPD
KERKAPENHADTIGSGRAIPIKQGMLLKRSGKWLKTWKKKYVTLCSNGVLTYYSSLGDYM
KNIHKKEIDLQTSTIKVPGKWPSLATSACTPISSSKSNGLSKDMDTGLGDSICFSPSISS
TTSPKLNPPPSPHANKKKHLKKKSTNNFMIVSATGQTWHFEATTYEERDAWVQAIQSQIL
ASLQSCESSKSKSQLTSQSEAMALQSIQNMRGNAHCVDCETQNPKWASLNLGVLMCIECS
GIHHSLGTRLSRVRSLELDDWPVELRKVMSSIGNDLANSIWEGSSQGQTKPSEKSTREEK
ERWIRSKYEEKLFLAPLPCTELSLGQQLLWATADEDLQTAILLLAHGSREEVNETCGEGD
GCTALHLACRKGNVVLAQLLIWYGVDVMARDAHGNTALTYARQASSQECINVLLQYGCPD
ECV
Download sequence
Identical sequences gi|117956371|ref|NP_001071154.1| ENSP00000415452 9606.ENSP00000415452 ENSP00000415452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]