SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118442828|ref|NP_001072983.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118442828|ref|NP_001072983.1|
Domain Number 1 Region: 8-142
Classification Level Classification E-value
Superfamily Cap-Gly domain 2.09e-36
Family Cap-Gly domain 0.00083
Further Details:      
 
Domain Number 2 Region: 107-349
Classification Level Classification E-value
Superfamily RNI-like 2.12e-29
Family Cyclin A/CDK2-associated p19, Skp2 0.041
Further Details:      
 
Domain Number 3 Region: 440-527
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.31e-21
Family Ubiquitin-related 0.0000261
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118442828|ref|NP_001072983.1|
Sequence length 527
Comment tubulin-specific chaperone E [Homo sapiens]
Sequence
MSDTLTADVIGRRVEVNGEHATVRFAGVVPPVAGPWLGVEWDNPERGKHDGSHEGTVYFK
CRHPTGGSFIRPNKVNFGTDFLTAIKNRYVLEDGPEEDRKEQIVTIGNKPVETIGFDSIM
KQQSQLSKLQEVSLRNCAVSCAGEKGGVAEACPNIRKVDLSKNLLSSWDEVIHIADQLRH
LEVLNVSENKLKFPSGSVLTGTLSVLKVLVLNQTGITWAEVLRCVAGCPGLEELYLESNN
IFISERPTDVLQTVKLLDLSSNQLIDENQLYLIAHLPRLEQLILSDTGISSLHFPDAGIG
CKTSMFPSLKYLVVNDNQISQWSFFNELEKLPSLRALSCLRNPLTKEDKEAETARLLIIA
SIGQLKTLNKCEILPEERRRAELDYRKAFGNEWKQAGGHKDPEKNRLSEEFLTAHPRYQF
LCLKYGAPEDWELKTQQPLMLKNQLLTLKIKYPHQLDQKVLEKQLPGSMTIQKVKGLLSR
LLKVPVSDLLLSYESPKKPGREIELENDLKSLQFYSVENGDCLLVRW
Download sequence
Identical sequences Q15813
gi|118442828|ref|NP_001072983.1| gi|4507375|ref|NP_003184.1| ENSP00000355560 ENSP00000384571 ENSP00000355560 ENSP00000384571 9606.ENSP00000355560 NP_001072983.1.87134 NP_001072983.1.92137 NP_003184.1.87134 NP_003184.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]