SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118572590|ref|NP_037502.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118572590|ref|NP_037502.3|
Domain Number 1 Region: 99-128,244-379,475-541
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000109
Family FAD/NAD-linked reductases, N-terminal and central domains 0.063
Further Details:      
 
Weak hits

Sequence:  gi|118572590|ref|NP_037502.3|
Domain Number - Region: 370-494
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.0787
Family Alcohol dehydrogenase-like, C-terminal domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|118572590|ref|NP_037502.3|
Sequence length 560
Comment oxidative stress-induced growth inhibitor 1 isoform 1 [Homo sapiens]
Sequence
MGKWRPRGCCRGNMQCRQEVPATLTSSELFSTRNQPQPQPQPLLADAPVPWAVASRMCLT
PGQGCGHQGQDEGPLPAPSPPPAMSSSRKDHLGASSSEPLPVIIVGNGPSGICLSYLLSG
YTPYTKPDAIHPHPLLQRKLTEAPGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDT
DFGGNMKSVLTWKHRKEHAIPHVVLGRNLPGGAWHSIEGSMVILSQGQWMGLPDLEVKDW
MQKKRRGLRNSRATAGDIAHYYRDYVVKKGLGHNFVSGAVVTAVEWGTPDPSSCGAQDSS
PLFQVSGFLTRNQAQQPFSLWARNVVLATGTFDSPARLGIPGEALPFIHHELSALEAATR
VGAVTPASDPVLIIGAGLSAADAVLYARHYNIPVIHAFRRAVDDPGLVFNQLPKMLYPEY
HKVHQMMREQSILSPSPYEGYRSLPRHQLLCFKEDCQAVFQDLEGVEKVFGVSLVLVLIG
SHPDLSFLPGAGADFAVDPDQPLSAKRNPIDVDPFTYQSTRQEGLYAMGPLAGDNFVRFV
QGGALAVASSLLRKETRKPP
Download sequence
Identical sequences Q9UJX0
gi|118572590|ref|NP_037502.3| ENSP00000343376 ENSP00000343376 ENSP00000343376 9606.ENSP00000343376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]