SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119395727|ref|NP_001223.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119395727|ref|NP_001223.2|
Domain Number 1 Region: 248-366
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.73e-55
Family Calsequestrin 0.00000141
Further Details:      
 
Domain Number 2 Region: 146-247
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.2e-27
Family Calsequestrin 0.0000613
Further Details:      
 
Domain Number 3 Region: 24-145
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.5e-19
Family Calsequestrin 0.0000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119395727|ref|NP_001223.2|
Sequence length 399
Comment calsequestrin-2 precursor [Homo sapiens]
Sequence
MKRTHLFIVGIYFLSSCRAEEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPV
SSDKVTQKQFQLKEIVLELVAQVLEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLYILKGD
RTIEFDGEFAADVLVEFLLDLIEDPVEIISSKLEVQAFERIEDYIKLIGFFKSEDSEYYK
AFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDEPIAIPNKPYTEEELVEF
VKEHQRPTLRRLRPEEMFETWEDDLNGIHIVAFAEKSDPDGYEFLEILKQVARDNTDNPD
LSILWIDPDDFPLLVAYWEKTFKIDLFRPQIGVVNVTDADSVWMEIPDDDDLPTAEELED
WIEDVLSGKINTEDDDEDDDDDDNSDEEDNDDSDDDDDE
Download sequence
Identical sequences O14958
gi|119395727|ref|NP_001223.2| 9606.ENSP00000261448 ENSP00000261448 ENSP00000261448 NP_001223.2.87134 NP_001223.2.92137 ENSP00000261448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]