SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|120587029|ref|NP_766638.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120587029|ref|NP_766638.2|
Domain Number 1 Region: 802-910
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-24
Family Spermadhesin, CUB domain 0.0024
Further Details:      
 
Domain Number 2 Region: 282-407
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.1e-19
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 30-166
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.38e-17
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 4 Region: 245-288
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000134
Family EGF-type module 0.016
Further Details:      
 
Domain Number 5 Region: 644-799
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000445
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 165-203
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000255
Family EGF-type module 0.02
Further Details:      
 
Domain Number 7 Region: 206-243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000762
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|120587029|ref|NP_766638.2|
Sequence length 988
Comment signal peptide, CUB and EGF-like domain-containing protein 1 precursor [Homo sapiens]
Sequence
MGAAAVRWHLCVLLALGTRGRLAGGSGLPGSVDVDECSEGTDDCHIDAICQNTPKSYKCL
CKPGYKGEGKQCEDIDECENDYYNGGCVHECINIPGNYRCTCFDGFMLAHDGHNCLDVDE
CQDNNGGCQQICVNAMGSYECQCHSGFFLSDNQHTCIHRSNEGMNCMNKDHGCAHICRET
PKGGVACDCRPGFDLAQNQKDCTLTCNYGNGGCQHSCEDTDTGPTCGCHQKYALHSDGRT
CIETCAVNNGGCDRTCKDTATGVRCSCPVGFTLQPDGKTCKDINECLVNNGGCDHFCRNT
VGSFECGCRKGYKLLTDERTCQDIDECSFERTCDHICINSPGSFQCLCHRGYILYGTTHC
GDVDECSMSNGSCDQGCVNTKGSYECVCPPGRRLHWNGKDCVETGKCLSRAKTSPRAQLS
CSKAGGVESCFLSCPAHTLFVPDSENSYVLSCGVPGPQGKALQKRNGTSSGLGPSCSDAP
TTPIKQKARFKIRDAKCHLRPHSQARAKETARQPLLDHCHVTFVTLKCDSSKKRRRGRKS
PSKEVSHITAEFEIETKMEEASDTCEADCLRKRAEQSLQAAIKTLRKSIGRQQFYVQVSG
TEYEVAQRPAKALEGQGACGAGQVLQDSKCVACGPGTHFGGELGQCVSCMPGTYQDMEGQ
LSCTPCPSSDGLGLPGARNVSECGGQCSPGFFSADGFKPCQACPVGTYQPEPGRTGCFPC
GGGLLTKHEGTTSFQDCEAKVHCSPGHHYNTTTHRCIRCPVGTYQPEFGQNHCITCPGNT
STDFDGSTNVTHCKNQHCGGELGDYTGYIESPNYPGDYPANAECVWHIAPPPKRRILIVV
PEIFLPIEDECGDVLVMRKSASPTSITTYETCQTYERPIAFTSRSRKLWIQFKSNEGNSG
KGFQVPYVTYDEDYQQLIEDIVRDGRLYASENHQEILKDKKLIKALFDVLAHPQNYFKYT
AQESKEMFPRSFIKLLRSKVSRFLRPYK
Download sequence
Identical sequences Q8IWY4
9606.ENSP00000354080 NYSGXRC-13066a ENSP00000354080 ENSP00000354080 NP_766638.2.87134 NP_766638.2.92137 gi|120587029|ref|NP_766638.2| ENSP00000290460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]