SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|120659787|ref|NP_001073351.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120659787|ref|NP_001073351.1|
Domain Number 1 Region: 396-660
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.23e-81
Family Protein kinases, catalytic subunit 0.0000204
Further Details:      
 
Domain Number 2 Region: 242-352
Classification Level Classification E-value
Superfamily PH domain-like 3.7e-36
Family Pleckstrin-homology domain (PH domain) 0.000000569
Further Details:      
 
Domain Number 3 Region: 101-158
Classification Level Classification E-value
Superfamily Cysteine-rich domain 6.43e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0022
Further Details:      
 
Domain Number 4 Region: 2-33
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000262
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|120659787|ref|NP_001073351.1|
Sequence length 721
Comment serine/threonine-protein kinase D2 isoform B [Homo sapiens]
Sequence
MLFGLVRQGLKCDGCGLNYHKRCAFSIPNNCSGARKRRLSSTSLASGHSVRLGTSESLPC
TAEELSRSTTELLPRRPPSSSSSSSASSYTGRPIELDKMLLSKVKVPHTFLIHSYTRPTV
CQACKKLLKGLFRQGLQCKDCKFNCHKRCATRVPNDCLGEALINGDVPMEEATDFSEADK
SALMDESEDSGVIPGSHSENALHASEEEEGEGGKAQSSLGYIPLMRVVQSVRHTTRKSST
TLREGWVVHYSNKDTLRKRHYWRLDCKCITLFQNNTTNRYYKEIPLSEILTVESAQNFSL
VPPGTNPHCFEIVTANATYFVGEMPGGTPGGPSGQGAEAARGWETAIRQALMPVILQDAP
SAPGHAPHRQASLSISVSNSQIQENVDIATVYQIFPDEVLGSGQFGVVYGGKHRKTGRDV
AVKVIDKLRFPTKQESQLRNEVAILQSLRHPGIVNLECMFETPEKVFVVMEKLHGDMLEM
ILSSEKGRLPERLTKFLITQILVALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFG
FARIIGEKSFRRSVVGTPAYLAPEVLLNQGYNRSLDMWSVGVIMYVSLSGTFPFNEDEDI
NDQIQNAAFMYPASPWSHISAGAIDLINNLLQVKMRKRYSVDKSLSHPWLQEYQTWLDLR
ELEGKMGERYITHESDDARWEQFAAEHPLPGSGLPTDRDLGGACPPQDHDMQGLAERISV
L
Download sequence
Identical sequences gi|120659787|ref|NP_001073351.1| NP_001073351.1.87134 NP_001073351.1.92137 XP_005258773.2.92137 ENSP00000469106 ENSP00000472744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]