SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|122937309|ref|NP_001073926.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|122937309|ref|NP_001073926.1|
Domain Number 1 Region: 57-328
Classification Level Classification E-value
Superfamily L domain-like 9.35e-59
Family Ngr ectodomain-like 0.0012
Further Details:      
 
Domain Number 2 Region: 362-455
Classification Level Classification E-value
Superfamily Immunoglobulin 8.02e-20
Family I set domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|122937309|ref|NP_001073926.1|
Sequence length 713
Comment leucine-rich repeat-containing protein 4B precursor [Homo sapiens]
Sequence
MARARGSPCPPLPPGRMSWPHGALLFLWLFSPPLGAGGGGVAVTSAAGGGSPPATSCPVA
CSCSNQASRVICTRRDLAEVPASIPVNTRYLNLQENGIQVIRTDTFKHLRHLEILQLSKN
LVRKIEVGAFNGLPSLNTLELFDNRLTTVPTQAFEYLSKLRELWLRNNPIESIPSYAFNR
VPSLRRLDLGELKRLEYISEAAFEGLVNLRYLNLGMCNLKDIPNLTALVRLEELELSGNR
LDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLKSLEELNLSHNNLMSLPHDLFTPL
HRLERVHLNHNPWHCNCDVLWLSWWLKETVPSNTTCCARCHAPAGLKGRYIGELDQSHFT
CYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTSVNWLTPNGTLMTHGSYRVRISVLHDGT
LNFTNVTVQDTGQYTCMVTNSAGNTTASATLNVSAVDPVAAGGTGSGGGGPGGSGGVGGG
SGGYTYFTTVTVETLETQPGEEALQPRGTEKEPPGPTTDGVWGGGRPGDAAGPASSSTTA
PAPRSSRPTEKAFTVPITDVTENALKDLDDVMKTTKIIIGCFVAITFMAAVMLVAFYKLR
KQHQLHKHHGPTRTVEIINVEDELPAASAVSVAAAAAVASGGGVGGDSHLALPALERDHL
NHHHYVAAAFKAHYSSNPSGGGCGGKGPPGLNSIHEPLLFKSGSKENVQETQI
Download sequence
Identical sequences A0A024R4I8 A0A2J8J1A3 A0A2J8U8X3 Q9NT99
9598.ENSPTRP00000019491 9606.ENSP00000373853 gi|122937309|ref|NP_001073926.1| ENSP00000373853 ENSP00000471502 NYSGRC-IgSF-LRC4B_HUMAN ENSP00000373853 ENSP00000471502 ENSP00000373853 ENSPTRP00000019491 NP_001073926.1.87134 NP_001073926.1.92137 XP_005259486.1.92137 XP_006723569.1.92137 XP_009434369.1.37143 XP_011525822.1.92137 XP_016792148.1.37143 XP_016792149.1.37143 XP_016792150.1.37143 ENSPTRP00000019491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]