SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|122937315|ref|NP_001073929.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|122937315|ref|NP_001073929.1|
Domain Number 1 Region: 149-482
Classification Level Classification E-value
Superfamily L domain-like 5.27e-53
Family Leucine rich effector protein YopM 0.03
Further Details:      
 
Domain Number 2 Region: 28-203
Classification Level Classification E-value
Superfamily L domain-like 1.14e-30
Family Internalin LRR domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|122937315|ref|NP_001073929.1|
Sequence length 560
Comment leucine-rich repeat and IQ domain-containing protein 4 [Homo sapiens]
Sequence
MSKDIKSVEHSPKIHQRNDPQHVNDRTFFIDASNQSLTAIPLEIFTFTELEEVHLENNQI
EEIPQEIQRLKNIRVLYLDKNNLRSLCPALGLLSSLESLDLSYNPIFSSSLVVVSFLHAL
RELRLYQTDLKEIPVVIFKNLHHLELLGLTGNHLKCLPKEIVNQTKLREIYLKRNQFEVF
PQELCVLYTLEIIDLDENKIGAIPEEIGHLTGLQKFYMASNNLPVLPASLCQCSQLSVLD
LSHNLLHSIPKSFAELRKMTEIGLSGNRLEKVPRLICRWTSLHLLYLGNTGLHRLRGSFR
CLVNLRFLDLSQNHLHHCPLQICALKNLEVLGLDDNKIGQLPSELGSLSKLKILGLTGNE
FLSFPEEVLSLASLEKLYIGQDQGFKLTYVPEHIRKLQSLKELYIENNHLEYLPVSLGSM
PNLEVLDCRHNLLKQLPDAICQAQALKELRLEDNLLTHLPENLDSLVNLKVLTLMDNPME
EPPKEVCAEGNEAIWKYLKENRNRNIMATKIQAWWRGTMVQRGFGKFGELLKPQKKGKTS
PKDKKGKKDVKGKPGKGKKK
Download sequence
Identical sequences A6NIV6
ENSP00000342188 NP_001073929.1.87134 NP_001073929.1.92137 XP_005247478.1.92137 XP_006713676.1.92137 XP_011511050.1.92137 ENSP00000342188 gi|122937315|ref|NP_001073929.1| 9606.ENSP00000342188 ENSP00000342188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]