SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|122937347|ref|NP_001073944.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|122937347|ref|NP_001073944.1|
Domain Number 1 Region: 276-456
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-24
Family Pleckstrin-homology domain (PH domain) 0.0038
Further Details:      
 
Domain Number 2 Region: 208-308
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000135
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Weak hits

Sequence:  gi|122937347|ref|NP_001073944.1|
Domain Number - Region: 510-527,674-725
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00879
Family Di-heme elbow motif 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|122937347|ref|NP_001073944.1|
Sequence length 761
Comment pleckstrin homology domain-containing family M member 3 [Homo sapiens]
Sequence
MEALEVDDISPALEVTEEFFSTLDSNLEKAVQQAEVYGIQEVPELVGHEVLSNITDNGAM
RNVTSLGKGGMIWDHCKSRLLETKAQNVFPAKEQFMVQRGTTPDNLSWMEQKEASTFNFF
NICQRRRDRPRSVNDLLDETSTFKPGHARSRSDITQVDWRVVLKTTPLQQQQQQQPLLQG
PHVTRPSFLLPSPNKIEDAQGNTEHKQTFPNILKKGYLEIRKDHDSYWQSCYAELSPYNL
YFYSLDSSGNQNLYATYQLSHFQSISVLGNLEARMVDTVLYDNTQLQLKAESPWEALDWG
QKLWEVVHAAVPGYMGRQNELTISPGLGHHDDYTQNHSFQKKTSGLLPPSPVLDSSKQYQ
NILKSGTLYRLTVQNNWKAFTFVLSRAYLMAFQPGKLDEDPLLSYNVDVCLAVQMDNLDG
CDSCFQVIFPQDVLRLRAETRQRAQEWMEALKIAANVARSSEQNLQVTLRNKPKDQMGGH
ELRKNKRQSVTTSFLSILTTLSLERGLTAQSFKCAGCQRSIGLSNGKAKVCNYSGWYYCS
SCHVDDSFLIPARIVHNWDTSKYKVSKQAKEFLEYVYEEPLIDIQQENAMLYHHAEPLAA
VLRLRQRLKSLRAYLFSCRAAVAEDLRRRIFPREYLLQQIHLYSLADLQQVIEGKLAPFL
GKVIKFATSHVYSCSLCSQKGFICEICNNGEILYPFEDISTSRCESCGAVFHSECKEKSV
PCPRCVRRELQKKQKSFWQRLNMDESLEEACTMFELSYQNT
Download sequence
Identical sequences Q6ZWE6
ENSP00000417003 ENSP00000417003 NYSGRC-122937347 gi|122937347|ref|NP_001073944.1| ENSP00000373899 9606.ENSP00000386217 NP_001073944.1.87134 NP_001073944.1.92137 XP_011509462.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]