SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|122937349|ref|NP_001073945.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|122937349|ref|NP_001073945.1|
Domain Number 1 Region: 137-228
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.78e-19
Family Thioltransferase 0.034
Further Details:      
 
Weak hits

Sequence:  gi|122937349|ref|NP_001073945.1|
Domain Number - Region: 232-290
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 0.000275
Family DnaJ/Hsp40 cysteine-rich domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|122937349|ref|NP_001073945.1|
Sequence length 290
Comment glutaredoxin domain-containing cysteine-rich protein 1 [Homo sapiens]
Sequence
MLKREMKPESDRPRKVRFRIASSHSGRVLKEVYEDGQPSGSLDSECASICGIDGLGDSDG
QQNGHIESEGDENENDQDSLLVLARAASEKGFGTRRVNILSKNGTVRGVKYKVSAGQALF
NNLTKVLQQPSTDLEFDRVVIYTTCLRVVRTTFERCELVRKIFQNHRVKFEEKNIALNGE
YGKELDERCRRVSEAPSLPVVFIDGHYLGGAEKILSMNESGELQDILTKIERVQHPHECP
SCGGFGFLPCSVCHGSKMSMFRNCFTDSFKALKCTACNENGLQRCKNCAG
Download sequence
Identical sequences A8MXD5
ENSP00000382670 NP_001073945.1.87134 NP_001073945.1.92137 ENSP00000382670 ENSP00000382670 gi|122937349|ref|NP_001073945.1| 9606.ENSP00000382670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]