SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|122937510|ref|NP_001074006.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|122937510|ref|NP_001074006.1|
Domain Number 1 Region: 54-132
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000311
Family S100 proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|122937510|ref|NP_001074006.1|
Sequence length 147
Comment sentan [Homo sapiens]
Sequence
MGGCMHSTQDKSLHLEGDPNPSAAPTSTCAPRKMPKRISISKQLASVKALRKCSDLEKAI
ATTALIFRNSSDSDGKLEKAIAKDLLQTQFRNFAEGQETKPKYREILSELDEHTENKLDF
EDFMILLLSITVMSDLLQNIRNVKIMK
Download sequence
Identical sequences A6NMZ2
NP_001074006.1.87134 NP_001074006.1.92137 gi|122937510|ref|NP_001074006.1| 9606.ENSP00000341442 ENSP00000341442 ENSP00000341442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]