SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|122939147|ref|NP_115885.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|122939147|ref|NP_115885.2|
Domain Number 1 Region: 517-730
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.53e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.000059
Further Details:      
 
Domain Number 2 Region: 323-445
Classification Level Classification E-value
Superfamily PH domain-like 2.04e-19
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Domain Number 3 Region: 19-98
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000105
Family SH3-domain 0.0025
Further Details:      
 
Domain Number 4 Region: 218-247
Classification Level Classification E-value
Superfamily WW domain 0.0000116
Family WW domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|122939147|ref|NP_115885.2|
Sequence length 731
Comment rho GTPase-activating protein 9 isoform 1 [Homo sapiens]
Sequence
MLSSRWWPSSWGILGLGPRSPPRGSQLCALYAFTYTGADGQQVSLAEGDRFLLLRKTNSD
WWLARRLEAPSTSRPIFVPAAYMIEESIPSQSPTTVIPGQLLWTPGPKLFHGSLEELSQA
LPSRAQASSEQPPPLPRKMCRSVSTDNLSPSLLKPFQEGPSGRSLSQEDLPSEASASTAG
PQPLMSEPPVYCNLVDLRRCPRSPPPGPACPLLQRLDAWEQHLDPNSGRCFYINSLTGCK
SWKPPRRSRSETNPGSMEGTQTLKRNNDVLQPQAKGFRSDTGTPEPLDPQGSLSLSQRTS
QLDPPALQAPRPLPQLLDDPHEVEKSGLLNMTKIAQGGRKLRKNWGPSWVVLTGNSLVFY
REPPPTAPSSGWGPAGSRPESSVDLRGAALAHGRHLSSRRNVLHIRTIPGHEFLLQSDHE
TELRAWHRALRTVIERLDRENPLELRLSGSGPAELSAGEDEEEESELVSKPLLRLSSRRS
SIRGPEGTEQNRVRNKLKRLIAKRPPLQSLQERGLLRDQVFGCQLESLCQREGDTVPSFL
RLCIAAVDKRGLDVDGIYRVSGNLAVVQKLRFLVDRERAVTSDGRYVFPEQPGQEGRLDL
DSTEWDDIHVVTGALKLFLRELPQPLVPPLLLPHFRAALALSESEQCLSQIQELIGSMPK
PNHDTLRYLLEHLCRVIAHSDKNRMTPHNLGIVFGPTLFRPEQETSDPAAHALYPGQLVQ
LMLTNFTSLFP
Download sequence
Identical sequences NP_115885.2.87134 NP_115885.2.92137 XP_011536958.1.92137 ENSP00000377380 ENSP00000377380 9606.ENSP00000377380 gi|122939147|ref|NP_115885.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]