SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|122939149|ref|NP_001073625.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|122939149|ref|NP_001073625.1|
Domain Number 1 Region: 333-546
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.94e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.000059
Further Details:      
 
Domain Number 2 Region: 139-261
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-19
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Domain Number 3 Region: 34-63
Classification Level Classification E-value
Superfamily WW domain 0.00000804
Family WW domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|122939149|ref|NP_001073625.1|
Sequence length 547
Comment rho GTPase-activating protein 9 isoform 3 [Homo sapiens]
Sequence
MSEPPVYCNLVDLRRCPRSPPPGPACPLLQRLDAWEQHLDPNSGRCFYINSLTGCKSWKP
PRRSRSETNPGSMEGTQTLKRNNDVLQPQAKGFRSDTGTPEPLDPQGSLSLSQRTSQLDP
PALQAPRPLPQLLDDPHEVEKSGLLNMTKIAQGGRKLRKNWGPSWVVLTGNSLVFYREPP
PTAPSSGWGPAGSRPESSVDLRGAALAHGRHLSSRRNVLHIRTIPGHEFLLQSDHETELR
AWHRALRTVIERLDRENPLELRLSGSGPAELSAGEDEEEESELVSKPLLRLSSRRSSIRG
PEGTEQNRVRNKLKRLIAKRPPLQSLQERGLLRDQVFGCQLESLCQREGDTVPSFLRLCI
AAVDKRGLDVDGIYRVSGNLAVVQKLRFLVDRERAVTSDGRYVFPEQPGQEGRLDLDSTE
WDDIHVVTGALKLFLRELPQPLVPPLLLPHFRAALALSESEQCLSQIQELIGSMPKPNHD
TLRYLLEHLCRVIAHSDKNRMTPHNLGIVFGPTLFRPEQETSDPAAHALYPGQLVQLMLT
NFTSLFP
Download sequence
Identical sequences ENSP00000397950 gi|122939149|ref|NP_001073625.1| ENSP00000397950 NP_001073625.1.87134 NP_001073625.1.92137 XP_016875290.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]