SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|12408656|ref|NP_005177.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|12408656|ref|NP_005177.2|
Domain Number 1 Region: 14-362
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.62e-138
Family Calpain large subunit, catalytic domain (domain II) 0.00000000000862
Further Details:      
 
Domain Number 2 Region: 366-526
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 2.09e-57
Family Calpain large subunit, middle domain (domain III) 0.0000000724
Further Details:      
 
Domain Number 3 Region: 532-712
Classification Level Classification E-value
Superfamily EF-hand 4.83e-47
Family Penta-EF-hand proteins 0.00000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|12408656|ref|NP_005177.2|
Sequence length 714
Comment calpain-1 catalytic subunit [Homo sapiens]
Sequence
MSEEIITPVYCTGVSAQVQKQRARELGLGRHENAIKYLGQDYEQLRVRCLQSGTLFRDEA
FPPVPQSLGYKDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHS
AEGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYQIILK
ALERGSLLGCSIDISSVLDMEAITFKKLVKGHAYSVTGAKQVNYRGQVVSLIRMRNPWGE
VEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLEICNLTPDALKS
RTIRKWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLDETDDPDDYGDRESGCSFV
LALMQKHRRRERRFGRDMETIGFAVYEVPPELVGQPAVHLKRDFFLANASRARSEQFINL
REVSTRFRLPPGEYVVVPSTFEPNKEGDFVLRFFSEKSAGTVELDDQIQANLPDEQVLSE
EEIDENFKALFRQLAGEDMEISVKELRTILNRIISKHKDLRTKGFSLESCRSMVNLMDRD
GNGKLGLVEFNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIESAGFKLNKKLYELII
TRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA
Download sequence
Identical sequences P07384
ENSP00000279247 gi|12408656|ref|NP_005177.2| gi|311893363|ref|NP_001185797.1| gi|311893365|ref|NP_001185798.1| ENSP00000279247 ENSP00000431686 ENSP00000431984 ENSP00000434176 ENSP00000435272 NP_001185797.1.87134 NP_001185797.1.92137 NP_001185798.1.87134 NP_001185798.1.92137 NP_005177.2.87134 NP_005177.2.92137 XP_006718761.1.92137 XP_011543594.1.92137 9606.ENSP00000279247 ENSP00000279247 ENSP00000431686 ENSP00000431984 ENSP00000434176 ENSP00000435272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]