SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|12408668|ref|NP_072098.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|12408668|ref|NP_072098.1|
Domain Number 1 Region: 3-177
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.31e-46
Family Phosducin 0.0000000647
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|12408668|ref|NP_072098.1|
Sequence length 194
Comment phosducin isoform b [Homo sapiens]
Sequence
MSSPQSRNGKDSKERVSRKMSIQEYELIHKEKEDENCLRKYRRQCMQDMHQKLSFGPRYG
FVYELETGKQFLETIEKELKITTIVVHIYEDGIKGCDALNSSLTCLAAEYPIVKFCKIKA
SNTGAGDRFSLDVLPTLLIYKGGELISNFISVAEQFAEEFFAGDVESFLNEYGLLPEREV
HVLEHTKIEEEDVE
Download sequence
Identical sequences A0A024R982
NP_072098.1.87134 NP_072098.1.92137 gi|12408668|ref|NP_072098.1| ENSP00000411564 ENSP00000422775 ENSP00000422775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]