SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|124249394|ref|NP_001074312.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124249394|ref|NP_001074312.1|
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.36e-38
Family Glutathione S-transferase (GST), N-terminal domain 0.0018
Further Details:      
 
Domain Number 2 Region: 81-236
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.59e-36
Family Glutathione S-transferase (GST), C-terminal domain 0.00000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|124249394|ref|NP_001074312.1|
Sequence length 244
Comment glutathione S-transferase theta-2B [Homo sapiens]
Sequence
MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDG
DFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLG
PLIGVQVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALG
YELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRI
ARIP
Download sequence
Identical sequences G9J6Q5 P0CG30
9606.ENSP00000290765 1ljr_A 1ljr_B 2ljr_A 2ljr_B 3ljr_A 3ljr_B ENSP00000290765 ENSP00000478389 NP_001074312.1.87134 NP_001074312.1.92137 1ljrA gi|124249394|ref|NP_001074312.1| gi|4504187|ref|NP_000845.1| ENSP00000290765 400226 ENSP00000290765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]