SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|12545406|ref|NP_072179.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|12545406|ref|NP_072179.1|
Domain Number 1 Region: 541-863
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.88e-91
Family p120GAP domain-like 0.0000000000112
Further Details:      
 
Domain Number 2 Region: 167-274
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-27
Family SH2 domain 0.00069
Further Details:      
 
Domain Number 3 Region: 2-87
Classification Level Classification E-value
Superfamily SH2 domain 4.58e-26
Family SH2 domain 0.00048
Further Details:      
 
Domain Number 4 Region: 292-399
Classification Level Classification E-value
Superfamily PH domain-like 1.12e-24
Family Pleckstrin-homology domain (PH domain) 0.0066
Further Details:      
 
Domain Number 5 Region: 419-555
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.17e-17
Family Synaptotagmin-like (S variant) 0.033
Further Details:      
 
Domain Number 6 Region: 95-168
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000042
Family SH3-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|12545406|ref|NP_072179.1|
Sequence length 870
Comment ras GTPase-activating protein 1 isoform 2 [Homo sapiens]
Sequence
MKGWYHGKLDRTIAEERLRQAGKSGSYLIRESDRRPGSFVLSFLSQMNVVNHFRIIAMCG
DYYIGGRRFSSLSDLIGYYSHVSCLLKGEKLLYPVAPPEPVEDRRRVRAILPYTKVPDTD
EISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVGREEDPHEGKIWFHGKIS
KQEAYNLLMTVGQVCSFLVRPSDNTPGDYSLYFRTNENIQRFKICPTPNNQFMMGGRYYN
SIGDIIDHYRKEQIVEGYYLKEPVPMQDQEQVLNDTVDGKEIYNTIRRKTKDAFYKNIVK
KGYLLKKGKGKRWKNLYFILEGSDAQLIYFESEKRATKPKGLIDLSVCSVYVVHDSLFGR
PNCFQIVVQHFSEEHYIFYFAGETPEQAEDWMKGLQAFCNLRKSSPGTSNKRLRQVSSLV
LHIEEAHKLPVKHFTNPYCNIYLNSVQVAKTHAREGQNPVWSEEFVFDDLPPDINRFEIT
LSNKTKKSKDPDILFMRCQLSRLQKGHATDEWFLLSSHIPLKGIEPGSLRVRARYSMEKI
MPEEEYSEFKELILQKELHVVYALSHVCGQDRTLLASILLRIFLHEKLESLLLCTLNDRE
ISMEDEATTLFRATTLASTLMEQYMKATATQFVHHALKDSILKIMESKQSCELSPSKLEK
NEDVNTNLTHLLNILSELVEKIFMASEILPPTLRYIYGCLQKSVQHKWPTNTTMRTRVVS
GFVFLRLICPAILNPRMFNIISDSPSPIAARTLILVAKSVQNLANLVEFGAKEPYMEGVN
PFIKSNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERG
AQQHVLKKLLAITELLQQKQNQYTKTNDVR
Download sequence
Identical sequences A0A2I2YTV7 A0A2J8NMX5
gi|12545406|ref|NP_072179.1| ENSP00000411221 ENSP00000411221 NP_072179.1.87134 NP_072179.1.92137 XP_001145642.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]