SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126091130|ref|NP_001075042.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126091130|ref|NP_001075042.1|
Domain Number 1 Region: 5-122
Classification Level Classification E-value
Superfamily PH domain-like 2.6e-25
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126091130|ref|NP_001075042.1|
Sequence length 587
Comment GRB2-associated-binding protein 3 isoform 1 [Homo sapiens]
Sequence
MSAGDAVCTGWLVKSPPERKLQRYAWRKRWFVLRRGRMSGNPDVLEYYRNKHSSKPIRVI
DLSECAVWKHVGPSFVRKEFQNNFVFIVKTTSRTFYLVAKTEQEMQVWVHSISQVCNLGH
LEDGAADSMESLSYTPSSLQPSSASSLLTAHAASSSLPRDDPNTNAVATEETRSESELLF
LPDYLVLSNCETGRLHHTSLPTRCDSWSNSDRSLEQASFDDVFVDCLQPLPSSHLVHPSC
HGSGAQEVPSSRPQAALIWSREINGPPRDHLSSSPLLESSLSSTIQVDKNQGSLPCGAKE
LDIMSNTPPPRPPKPSHLSERRQEEWSTHSGSKKPECTLVPRRISLSGLDNMRTWKADVE
GQSLRHRDKRLSLNLPCRFSPMYPTASASIEDSYVPMSPQAGASGLGPHCSPDDYIPMNS
GSISSPLPELPANLEPPPVNRDLKPQRKSRPPPLDLRNLSIIREHASLTRTRTVPCSRTS
FLSPERNGINSARFFANPVSREDEESYIEMEEHRTASSLSSGALTWTKKFSLDYLALDFN
SASPAPMQQKLLLSEEQRVDYVQVDEQKTQALQSTKQEWTDERQSKV
Download sequence
Identical sequences G3QFF6
ENSGGOP00000001027 ENSP00000399588 ENSP00000470124 ENSP00000399588 9606.ENSP00000399588 gi|126091130|ref|NP_001075042.1| ENSP00000412258 NP_001075042.1.87134 NP_001075042.1.92137 XP_004065198.1.27298 XP_005274705.1.92137 XP_006724867.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]