SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|13124888|ref|NP_056322.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13124888|ref|NP_056322.2|
Domain Number 1 Region: 399-544
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-26
Family MAM domain 0.0013
Further Details:      
 
Domain Number 2 Region: 138-263
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000314
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 94-143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000177
Family EGF-type module 0.0052
Further Details:      
 
Weak hits

Sequence:  gi|13124888|ref|NP_056322.2|
Domain Number - Region: 60-102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0239
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|13124888|ref|NP_056322.2|
Sequence length 553
Comment epidermal growth factor-like protein 6 isoform 1 precursor [Homo sapiens]
Sequence
MPLPWSLALPLLLSWVAGGFGNAASARHHGLLASARQPGVCHYGTKLACCYGWRRNSKGV
CEATCEPGCKFGECVGPNKCRCFPGYTGKTCSQDVNECGMKPRPCQHRCVNTHGSYKCFC
LSGHMLMPDATCVNSRTCAMINCQYSCEDTEEGPQCLCPSSGLRLAPNGRDCLDIDECAS
GKVICPYNRRCVNTFGSYYCKCHIGFELQYISGRYDCIDINECTMDSHTCSHHANCFNTQ
GSFKCKCKQGYKGNGLRCSAIPENSVKEVLRAPGTIKDRIKKLLAHKNSMKKKAKIKNVT
PEPTRTPTPKVNLQPFNYEEIVSRGGNSHGGKKGNEEKMKEGLEDEKREEKALKNDIEER
SLRGDVFFPKVNEAGEFGLILVQRKALTSKLEHKDLNISVDCSFNHGICDWKQDREDDFD
WNPADRDNAIGFYMAVPALAGHKKDIGRLKLLLPDLQPQSNFCLLFDYRLAGDKVGKLRV
FVKNSNNALAWEKTTSEDEKWKTGKIQLYQGTDATKSIIFEAERGKGKTGEIAVDGVLLV
SGLCPDSLLSVDD
Download sequence
Identical sequences Q8IUX8
ENSP00000355126 9606.ENSP00000355126 NP_056322.2.87134 NP_056322.2.92137 gi|13124888|ref|NP_056322.2| ENSP00000355126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]