SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|13129130|ref|NP_077018.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|13129130|ref|NP_077018.1|
Domain Number - Region: 79-143
Classification Level Classification E-value
Superfamily EF-hand 0.0334
Family Calmodulin-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|13129130|ref|NP_077018.1|
Sequence length 331
Comment hypothetical protein LOC79096 isoform 3 [Homo sapiens]
Sequence
MLSPERLALPDYEYLAQRHVLTYMEDAVCQLLENREDISQYGIARFFTEYFNSVCQGTHI
LFREFSFVQATPHNRVSFLRAFWRCFRTVGKNGDLLTMKEYHCLLQLLCPDFPLELTQKA
ARIVLMDDAMDCLMSFSDFLFAFQIQFYYSEFLDSVAAIYEDLLSGKNPNTVIVPTSSSG
QHRQRPALGGAGTLEGVEASLFYQCLENLCDRHKYSCPPPALVKEALSNVQRLTFYGFLM
ALSKHRGINQALGALPDKGDLMHDPAMDEELERLLAQVPGLVNSVTASPEASCLPSRTPP
RVGSPWRPLHHSRKVDGESDGSTEETDESET
Download sequence
Identical sequences Q9H6J7
HR2009 ENSP00000278460 gi|13129130|ref|NP_077018.1| ENSP00000278460 NP_077018.1.87134 NP_077018.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]