SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|132626790|ref|NP_056442.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|132626790|ref|NP_056442.2|
Domain Number 1 Region: 30-179
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-44
Family Phosphotyrosine-binding domain (PTB) 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|132626790|ref|NP_056442.2|
Sequence length 308
Comment low density lipoprotein receptor adapter protein 1 [Homo sapiens]
Sequence
MDALKSAGRALIRSPSLAKQSWGGGGRHRKLPENWTDTRETLLEGMLFSLKYLGMTLVEQ
PKGEELSAAAIKRIVATAKASGKKLQKVTLKVSPRGIILTDNLTNQLIENVSIYRISYCT
ADKMHDKVFAYIAQSQHNQSLECHAFLCTKRKMAQAVTLTVAQAFKVAFEFWQVSKEEKE
KRDKASQEGGDVLGARQDCTPSLKSLVATGNLLDLEETAKAPLSTVSANTTNMDEVPRPQ
ALSGSSVVWELDDGLDEAFSRLAQSRTNPQVLDTGLTAQDMHYAQCLSPVDWDKPDSSGT
EQDDLFSF
Download sequence
Identical sequences Q5SW96
ENSP00000363458 ENSP00000363458 gi|132626790|ref|NP_056442.2| ENSP00000363458 NP_056442.2.87134 NP_056442.2.92137 9606.ENSP00000363458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]