SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|13325064|ref|NP_001399.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13325064|ref|NP_001399.1|
Domain Number 1 Region: 1348-1575
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.16e-39
Family Laminin G-like module 0.0028
Further Details:      
 
Domain Number 2 Region: 393-505
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-31
Family Cadherin 0.00078
Further Details:      
 
Domain Number 3 Region: 809-921
Classification Level Classification E-value
Superfamily Cadherin-like 1.37e-28
Family Cadherin 0.00069
Further Details:      
 
Domain Number 4 Region: 498-603
Classification Level Classification E-value
Superfamily Cadherin-like 7e-28
Family Cadherin 0.001
Further Details:      
 
Domain Number 5 Region: 1598-1791
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-27
Family Laminin G-like module 0.028
Further Details:      
 
Domain Number 6 Region: 283-391
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-26
Family Cadherin 0.0012
Further Details:      
 
Domain Number 7 Region: 909-1024
Classification Level Classification E-value
Superfamily Cadherin-like 7.28e-26
Family Cadherin 0.0013
Further Details:      
 
Domain Number 8 Region: 178-281
Classification Level Classification E-value
Superfamily Cadherin-like 8.64e-26
Family Cadherin 0.0016
Further Details:      
 
Domain Number 9 Region: 700-804
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-25
Family Cadherin 0.0019
Further Details:      
 
Domain Number 10 Region: 603-704
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-21
Family Cadherin 0.0015
Further Details:      
 
Domain Number 11 Region: 1017-1119
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000428
Family Cadherin 0.0077
Further Details:      
 
Domain Number 12 Region: 1275-1365,1562-1611
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000424
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 13 Region: 1924-1964
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000393
Family Laminin-type module 0.0094
Further Details:      
 
Domain Number 14 Region: 1830-1876
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000313
Family EGF-type module 0.013
Further Details:      
 
Domain Number 15 Region: 1795-1829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000536
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  gi|13325064|ref|NP_001399.1|
Domain Number - Region: 2425-2639
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0558
Family Rhodopsin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|13325064|ref|NP_001399.1|
Sequence length 2923
Comment cadherin EGF LAG seven-pass G-type receptor 2 precursor [Homo sapiens]
Sequence
MRSPATGVPLPTPPPPLLLLLLLLLPPPLLGDQVGPCRSLGSRGRGSSGACAPMGWLCPS
SASNLWLYTSRCRDAGTELTGHLVPHHDGLRVWCPESEAHIPLPPAPEGCPWSCRLLGIG
GHLSPQGKLTLPEEHPCLKAPRLRCQSCKLAQAPGLRAGERSPEESLGGRRKRNVNTAPQ
FQPPSYQATVPENQPAGTPVASLRAIDPDEGEAGRLEYTMDALFDSRSNQFFSLDPVTGA
VTTAEELDRETKSTHVFRVTAQDHGMPRRSALATLTILVTDTNDHDPVFEQQEYKESLRE
NLEVGYEVLTVRATDGDAPPNANILYRLLEGSGGSPSEVFEIDPRSGVIRTRGPVDREEV
ESYQLTVEASDQGRDPGPRSTTAAVFLSVEDDNDNAPQFSEKRYVVQVREDVTPGAPVLR
VTASDRDKGSNAVVHYSIMSGNARGQFYLDAQTGALDVVSPLDYETTKEYTLRVRAQDGG
RPPLSNVSGLVTVQVLDINDNAPIFVSTPFQATVLESVPLGYLVLHVQAIDADAGDNARL
EYRLAGVGHDFPFTINNGTGWISVAAELDREEVDFYSFGVEARDHGTPALTASASVSVTV
LDVNDNNPTFTQPEYTVRLNEDAAVGTSVVTVSAVDRDAHSVITYQITSGNTRNRFSITS
QSGGGLVSLALPLDYKLERQYVLAVTASDGTRQDTAQIVVNVTDANTHRPVFQSSHYTVN
VNEDRPAGTTVVLISATDEDTGENARITYFMEDSIPQFRIDADTGAVTTQAELDYEDQVS
YTLAITARDNGIPQKSDTTYLEILVNDVNDNAPQFLRDSYQGSVYEDVPPFTSVLQISAT
DRDSGLNGRVFYTFQGGDDGDGDFIVESTSGIVRTLRRLDRENVAQYVLRAYAVDKGMPP
ARTPMEVTVTVLDVNDNPPVFEQDEFDVFVEENSPIGLAVARVTATDPDEGTNAQIMYQI
VEGNIPEVFQLDIFSGELTALVDLDYEDRPEYVLVIQATSAPLVSRATVHVRLLDRNDNP
PVLGNFEILFNNYVTNRSSSFPGGAIGRVPAHDPDISDSLTYSFERGNELSLVLLNASTG
ELKLSRALDNNRPLEAIMSVLVSDGVHSVTAQCALRVTIITDEMLTHSITLRLEDMSPER
FLSPLLGLFIQAVAATLATPPDHVVVFNVQRDTDAPGGHILNVSLSVGQPPGPGGGPPFL
PSEDLQERLYLNRSLLTAISAQRVLPFDDNICLREPCENYMRCVSVLRFDSSAPFIASSS
VLFRPIHPVGGLRCRCPPGFTGDYCETEVDLCYSRPCGPHGRCRSREGGYTCLCRDGYTG
EHCEVSARSGRCTPGVCKNGGTCVNLLVGGFKCDCPSGDFEKPYCQVTTRSFPAHSFITF
RGLRQRFHFTLALSFATKERDGLLLYNGRFNEKHDFVALEVIQEQVQLTFSAGESTTTVS
PFVPGGVSDGQWHTVQLKYYNKPLLGQTGLPQGPSEQKVAVVTVDGCDTGVALRFGSVLG
NYSCAAQGTQGGSKKSLDLTGPLLLGGVPDLPESFPVRMRQFVGCMRNLQVDSRHIDMAD
FIANNGTVPGCPAKKNVCDSNTCHNGGTCVNQWDAFSCECPLGFGGKSCAQEMANPQHFL
GSSLVAWHGLSLPISQPWYLSLMFRTRQADGVLLQAITRGRSTITLQLREGHVMLSVEGT
GLQASSLRLEPGRANDGDWHHAQLALGASGGPGHAILSFDYGQQRAEGNLGPRLHGLHLS
NITVGGIPGPAGGVARGFRGCLQGVRVSDTPEGVNSLDPSHGESINVEQGCSLPDPCDSN
PCPANSYCSNDWDSYSCSCDPGYYGDNCTNVCDLNPCEHQSVCTRKPSAPHGYTCECPPN
YLGPYCETRIDQPCPRGWWGHPTCGPCNCDVSKGFDPDCNKTSGECHCKENHYRPPGSPT
CLLCDCYPTGSLSRVCDPEDGQCPCKPGVIGRQCDRCDNPFAEVTTNGCEVNYDSCPRAI
EAGIWWPRTRFGLPAAAPCPKGSFGTAVRHCDEHRGWLPPNLFNCTSITFSELKGFAERL
QRNESGLDSGRSQQLALLLRNATQHTAGYFGSDVKVAYQLATRLLAHESTQRGFGLSATQ
DVHFTENLLRVGSALLDTANKRHWELIQQTEGGTAWLLQHYEAYASALAQNMRHTYLSPF
TIVTPNIVISVVRLDKGNFAGAKLPRYEALRGEQPPDLETTVILPESVFRETPPVVRPAG
PGEAQEPEELARRQRRHPELSQGEAVASVIIYRTLAGLLPHNYDPDKRSLRVPKRPIINT
PVVSISVHDDEELLPRALDKPVTVQFRLLETEERTKPICVFWNHSILVSGTGGWSARGCE
VVFRNESHVSCQCNHMTSFAVLMDVSRRENGEILPLKTLTYVALGVTLAALLLTFFFLTL
LRILRSNQHGIRRNLTAALGLAQLVFLLGINQADLPFACTVIAILLHFLYLCTFSWALLE
ALHLYRALTEVRDVNTGPMRFYYMLGWGVPAFITGLAVGLDPEGYGNPDFCWLSIYDTLI
WSFAGPVAFAVSMSVFLYILAARASCAAQRQGFEKKGPVSGLQPSFAVLLLLSATWLLAL
LSVNSDTLLFHYLFATCNCIQGPFIFLSYVVLSKEVRKALKLACSRKPSPDPALTTKSTL
TSSYNCPSPYADGRLYQPYGDSAGSLHSTSRSGKSQPSYIPFLLREESALNPGQGPPGLG
DPGSLFLEGQDQQHDPDTDSDSDLSLEDDQSGSYASTHSSDSEEEEEEEEEEAAFPGEQG
WDSLLGPGAERLPLHSTPKDGGPGPGKAPWPGDFGTTAKESSGNGAPEERLRENGDALSR
EGSLGPLPGSSAQPHKGILKKKCLPTISEKSSLLRLPLEQCTGSSRGSSASEGSRGGPPP
RPPPRQSLQEQLNGVMPIAMSIKAGTVDEDSSGSEFLFFNFLH
Download sequence
Identical sequences Q9HCU4
NP_001399.1.87134 NP_001399.1.92137 NYSGXRC-13044a 9606.ENSP00000271332 ENSP00000271332 gi|13325064|ref|NP_001399.1| ENSP00000271332 ENSP00000271332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]