SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|13375646|ref|NP_078785.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13375646|ref|NP_078785.1|
Domain Number 1 Region: 41-299
Classification Level Classification E-value
Superfamily L domain-like 1.51e-44
Family Ngr ectodomain-like 0.014
Further Details:      
 
Domain Number 2 Region: 294-389
Classification Level Classification E-value
Superfamily Immunoglobulin 1.45e-18
Family I set domains 0.021
Further Details:      
 
Domain Number 3 Region: 424-502
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000443
Family Fibronectin type III 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|13375646|ref|NP_078785.1|
Sequence length 628
Comment leucine-rich repeat and fibronectin type-III domain-containing protein 3 precursor [Homo sapiens]
Sequence
MAILPLLLCLLPLAPASSPPQSATPSPCPRRCRCQTQSLPLSVLCPGAGLLFVPPSLDRR
AAELRLADNFIASVRRRDLANMTGLLHLSLSRNTIRHVAAGAFADLRALRALHLDGNRLT
SLGEGQLRGLVNLRHLILSNNQLAALAAGALDDCAETLEDLDLSYNNLEQLPWEALGRLG
NVNTLGLDHNLLASVPAGAFSRLHKLARLDMTSNRLTTIPPDPLFSRLPLLARPRGSPAS
ALVLAFGGNPLHCNCELVWLRRLAREDDLEACASPPALGGRYFWAVGEEEFVCEPPVVTH
RSPPLAVPAGRPAALRCRAVGDPEPRVRWVSPQGRLLGNSSRARAFPNGTLELLVTEPGD
GGIFTCIAANAAGEATAAVELTVGPPPPPQLANSTSCDPPRDGDPDALTPPSAASASAKV
ADTGPPTDRGVQVTEHGATAALVQWPDQRPIPGIRMYQIQYNSSADDILVYRMIPAESRS
FLLTDLASGRTYDLCVLAVYEDSATGLTATRPVGCARFSTEPALRPCGAPHAPFLGGTMI
IALGGVIVASVLVFIFVLLMRYKVHGGQPPGKAKIPAPVSSVCSQTNGALGPTPTPAPPA
PEPAALRAHTVVQLDCEPWGPGHEPVGP
Download sequence
Identical sequences Q9BTN0
NYSGRC-IgSF-LRFN3_HUMAN NP_078785.1.87134 NP_078785.1.92137 XP_016882791.1.92137 ENSP00000246529 ENSP00000466989 ENSP00000246529 gi|13375646|ref|NP_078785.1| ENSP00000246529 ENSP00000466989 9606.ENSP00000246529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]