SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|13375827|ref|NP_078889.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13375827|ref|NP_078889.1|
Domain Number 1 Region: 11-132
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-29
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 2 Region: 148-212
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 9.11e-22
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|13375827|ref|NP_078889.1|
Sequence length 249
Comment pleckstrin homology domain-containing family F member 2 [Homo sapiens]
Sequence
MVDRLANSEANTRRISIVENCFGAAGQPLTIPGRVLIGEGVLTKLCRKKPKARQFFLFND
ILVYGNIVIQKKKYNKQHIIPLENVTIDSIKDEGDLRNGWLIKTPTKSFAVYAATATEKS
EWMNHINKCVTDLLSKSGKTPSNEHAAVWVPDSEATVCMRCQKAKFTPVNRRHHCRKCGF
VVCGPCSEKRFLLPSQSSKPVRICDFCYDLLSAGDMATCQPARSDSYSQSLKSPLNDMSD
DDDDDDSSD
Download sequence
Identical sequences G3RXJ3 H2QWG2 Q9H8W4
NP_078889.1.87134 NP_078889.1.92137 XP_003821724.1.60992 XP_016815190.1.37143 XP_018887397.1.27298 ENSP00000322373 ENSP00000427792 ENSP00000322373 ENSP00000427792 9598.ENSPTRP00000034949 9606.ENSP00000322373 ENSPTRP00000034949 ENSGGOP00000020529 ENSGGOP00000020529 ENSPTRP00000034949 ENSP00000322373 gi|13375827|ref|NP_078889.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]