SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|133930786|ref|NP_115960.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|133930786|ref|NP_115960.2|
Domain Number 1 Region: 67-106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000367
Family EGF-type module 0.019
Further Details:      
 
Domain Number 2 Region: 330-636
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000659
Family Rhodopsin-like 0.035
Further Details:      
 
Domain Number 3 Region: 22-119
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000497
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|133930786|ref|NP_115960.2|
Sequence length 652
Comment EGF-like module-containing mucin-like hormone receptor-like 3 [Homo sapiens]
Sequence
MQGPLLLPGLCFLLSLFGAVTQKTKTSCAKCPPNASCVNNTHCTCNHGYTSGSGQKLFTF
PLETCNDINECTPPYSVYCGFNAVCYNVEGSFYCQCVPGYRLHSGNEQFSNSNENTCQDT
TSSKTTEGRKELQKIVDKFESLLTNQTLWRTEGRQEISSTATTILRDVESKVLETALKDP
EQKVLKIQNDSVAIETQAITDNCSEERKTFNLNVQMNSMDIRCSDIIQGDTQGPSAIAFI
SYSSLGNIINATFFEEMDKKDQVYLNSQVVSAAIGPKRNVSLSKSVTLTFQHVKMTPSTK
KVFCVYWKSTGQGSQWSRDGCFLIHVNKSHTMCNCSHLSSFAVLMALTSQEEDPVLTVIT
YVGLSVSLLCLLLAALTFLLCKAIRNTSTSLHLQLSLCLFLAHLLFLVGIDRTEPKVLCS
IIAGALHYLYLAAFTWMLLEGVHLFLTARNLTVVNYSSINRLMKWIMFPVGYGVPAVTVA
ISAASWPHLYGTADRCWLHLDQGFMWSFLGPVCAIFSANLVLFILVFWILKRKLSSLNSE
VSTIQNTRMLAFKATAQLFILGCTWCLGLLQVGPAAQVMAYLFTIINSLQGFFIFLVYCL
LSQQVQKQYQKWFREIVKSKSESETYTLSSKMGPDSKPSEGDVFPGQVKRKY
Download sequence
Identical sequences Q9BY15
9606.ENSP00000253673 ENSP00000253673 ENSP00000340758 ENSP00000253673 gi|133930786|ref|NP_115960.2| NP_115960.2.87134 NP_115960.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]