SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134288867|ref|NP_997527.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134288867|ref|NP_997527.2|
Domain Number 1 Region: 155-256
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000298
Family 28-residue LRR 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|134288867|ref|NP_997527.2|
Sequence length 315
Comment leucine-rich repeat-containing protein C22orf36 [Homo sapiens]
Sequence
MGARLGRRAGPEAGSEAGAAAGCGPAPYERRVRWLREIQSTLRERRPERARQLLRLLRQD
LGLERTLLPDILYRDVAFLNPVDPISHDLLVNLARDLQCPKKDYELWKSSDKICRQLIYH
LTPHSKQQQGSSLRQRKTQSCLKSSLQKTLLAGETVDLSGIPLSTQDVQHITRYLSSHGA
VLAVLDLSFTGLSDELLHLLLPSLWALPRLTQLLLNGNRLTRATARKLTDAIKDTTKFPA
LAWVDLGNNVDVASLPQPLLVGLRRRLSQRTSLPTIYEGLDLEPEGSAAGATTPASTWDS
TAAGLGPEPQACCAR
Download sequence
Identical sequences Q2VPJ9 Q3KRG1
ENSP00000320520 gi|134288867|ref|NP_997527.2| ENSP00000320520 NP_997527.2.87134 NP_997527.2.92137 9606.ENSP00000320520 ENSP00000320520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]