SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|13540513|ref|NP_110385.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13540513|ref|NP_110385.1|
Domain Number 1 Region: 517-916
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.96e-117
Family Oxysterol-binding protein 0.0011
Further Details:      
 
Domain Number 2 Region: 185-286
Classification Level Classification E-value
Superfamily PH domain-like 5.91e-24
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 
Weak hits

Sequence:  gi|13540513|ref|NP_110385.1|
Domain Number - Region: 369-425
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0815
Family DNA-binding N-terminal domain of transcription activators 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|13540513|ref|NP_110385.1|
Sequence length 916
Comment oxysterol-binding protein 2 isoform a [Homo sapiens]
Sequence
MGKAAAPSRGGGCGGRSRGLSSLFTVVPCLSCHTAAPGMSASTSGSGPEPKPQPQPVPEP
ERGPLSEQVSEAVSEAVPRSEPVSETTSEPEPGAGQPSELLQGSRPGSESSSGVGAGPFT
KAASEPLSRAVGSATFLRPESGSLPALKPLPLLRPGQAKTPLGVPMSGTGTTSSAPLALL
PLDSFEGWLLKWTNYLKGYQRRWFVLGNGLLSYYRNQGEMAHTCRGTINLSTAHIDTEDS
CGILLTSGARSYHLKASSEVDRQQWITALELAKAKAVRVMNTHSDDSGDDDEATTPADKS
ELHHTLKNLSLKLDDLSTCNDLIAKHGAALQRSLTELDGLKIPSESGEKLKVVNERATLF
RITSNAMINACRDFLELAEIHSRKWQRALQYEQEQRVHLEETIEQLAKQHNSLERAFHSA
PGRPANPSKSFIEGSLLTPKGEDSEEDEDTEYFDAMEDSTSFITVITEAKEDSRKAEGST
GTSSVDWSSADNVLDGASLVPKGSSKVKRRVRIPNKPNYSLNLWSIMKNCIGRELSRIPM
PVNFNEPLSMLQRLTEDLEYHHLLDKAVHCTSSVEQMCLVAAFSVSSYSTTVHRIAKPFN
PMLGETFELDRLDDMGLRSLCEQVSHHPPSAAHYVFSKHGWSLWQEITISSKFRGKYISI
MPLGAIHLEFQASGNHYVWRKSTSTVHNIIVGKLWIDQSGDIEIVNHKTNDRCQLKFLPY
SYFSKEAARKVTGVVSDSQGKAHYVLSGSWDEQMECSKVMHSSPSSPSSDGKQKTVYQTL
SAKLLWKKYPLPENAENMYYFSELALTLNEHEEGVAPTDSRLRPDQRLMEKGRWDEANTE
KQRLEEKQRLSRRRRLEACGPGSSCSSEEEKEADAYTPLWFEKRLDPLTGEMACVYKGGY
WEAKEKQDWHMCPNIF
Download sequence
Identical sequences Q969R2
gi|13540513|ref|NP_110385.1| 9606.ENSP00000332576 ENSP00000332576 ENSP00000332576 NP_110385.1.87134 NP_110385.1.92137 ENSP00000384213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]