SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|13775198|ref|NP_112576.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13775198|ref|NP_112576.1|
Domain Number 1 Region: 2-92
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.63e-25
Family SH3BGR (SH3-binding, glutamic acid-rich protein-like) 0.0000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|13775198|ref|NP_112576.1|
Sequence length 93
Comment SH3 domain-binding glutamic acid-rich-like protein 3 [Homo sapiens]
Sequence
MSGLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNPKAT
PPQIVNGDQYCGDYELFVEAVEQNTLQEFLKLA
Download sequence
Identical sequences A0A0B4J1B8 A0A0D9S850 A0A1S2ZPN5 A0A1S3GJP0 A0A1U7V0Q0 A0A250Y8W7 A0A2F0B9R7 A0A2K5E6Y5 A0A2K5RTL8 A0A2K6H101 F7HKN5 G1LVF8 G1TCM9 G3T941 G5AUR1 H9EP83 I3M5G3 I7G469 K7CEW1 L8IJI9 M3WHM8 M3YWC1 Q3ZCL8 Q9H299
ENSMPUP00000015631 ENSP00000270792 ENSMPUP00000015631 ENSLAFP00000010266 ENSSTOP00000004567 ENSPANP00000005007 ENSSTOP00000004567 ENSECAP00000009685 ENSAMEP00000011059 ENSOCUP00000014546 ENSP00000270792 d1sj6a1 HGL_H00000363361 ENSLAFP00000010266 ENSCJAP00000017844 ENSAMEP00000011059 ENSNLEP00000011289 ENSNLEP00000011289 ENSOCUP00000014546 ENSECAP00000009685 9606.ENSP00000270792 9796.ENSECAP00000009685 9913.ENSBTAP00000012599 9986.ENSOCUP00000014546 ENSCJAP00000017854 NP_001029935.1.59421 NP_001029935.1.76553 NP_001229384.1.31192 NP_112576.1.87134 NP_112576.1.92137 XP_002913348.1.58354 XP_004005144.1.66739 XP_004425829.1.5094 XP_004642895.1.9945 XP_004657545.1.11716 XP_004741166.1.14098 XP_004850700.1.39548 XP_005353137.1.66349 XP_005394908.1.28644 XP_005895938.1.15283 XP_006055508.1.26621 XP_006159542.2.99106 XP_006196875.1.17985 XP_006883551.1.29581 XP_007078215.1.5354 XP_007178724.1.59432 XP_007459179.1.90284 XP_007522618.1.11023 XP_008071242.1.4292 XP_008146271.1.99482 XP_008527245.1.77740 XP_008584325.1.73410 XP_010828400.1.44457 XP_010946324.1.22495 XP_010992031.1.51371 XP_011282820.1.62641 XP_011810986.1.43180 XP_011970967.2.54773 XP_012295451.1.9421 XP_012501447.1.63892 XP_012605991.1.48125 XP_012888444.1.60039 XP_014710477.1.49734 XP_015340950.1.40921 XP_016072017.1.3490 XP_017518981.1.32401 XP_017911823.1.57651 XP_019287963.1.44245 XP_019505679.1.44202 XP_019569504.1.88060 XP_019836303.1.53367 XP_020014341.1.5219 XP_020764865.1.74333 XP_854998.2.84170 gi|13775198|ref|NP_112576.1| ENSP00000270792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]