SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|13899241|ref|NP_113614.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13899241|ref|NP_113614.1|
Domain Number 1 Region: 46-146
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000144
Family Calmodulin-like 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|13899241|ref|NP_113614.1|
Sequence length 150
Comment allograft inflammatory factor 1-like isoform 1 [Homo sapiens]
Sequence
MSGELSNRFQGGKAFGLLKARQERRLAEINREFLCDQKYSDEENLPEKLTAFKEKYMEFD
LNNEGEIDLMSLKRMMEKLGVPKTHLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVL
KLVMMFEGKANESSPKPVGPPPERDIASLP
Download sequence
Identical sequences A0A2J8UJC0 K7B1J2 Q9BQI0
ENSP00000247291 ENSP00000247291 9606.ENSP00000247291 NP_113614.1.87134 NP_113614.1.92137 XP_009455805.2.37143 2jjz_B 2jjz_C 2jjz_D 2vtg_A gi|13899241|ref|NP_113614.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]