SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|13899317|ref|NP_113657.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13899317|ref|NP_113657.1|
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.81e-22
Family SH3BGR (SH3-binding, glutamic acid-rich protein-like) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|13899317|ref|NP_113657.1|
Sequence length 107
Comment SH3 domain-binding glutamic acid-rich-like protein 2 [Homo sapiens]
Sequence
MVIRVFIASSSGFVAIKKKQQDVVRFLEANKIEFEEVDITMSEEQRQWMYKNVPPEKKPT
QGNPLPPQIFNGDRYCGDYDSFFESKESNTVFSFLGLKPRLASKAEP
Download sequence
Identical sequences A0A096NPI1 A0A2I3HKF9 A0A2I3TIY5 A0A2K5HB05 A0A2K5KID8 A0A2K5V5S2 A0A2K5Z5Z7 A0A2K6AVD0 A0A2K6JRP3 A0A2K6Q0W0 G3RR85 H2PJN0 H9G0H1 Q9UJC5
9600.ENSPPYP00000018798 9606.ENSP00000358853 NP_113657.1.87134 NP_113657.1.92137 XP_001146260.2.37143 XP_003258313.1.23891 XP_004044371.1.27298 XP_005552555.1.63531 XP_008004616.1.81039 XP_009240298.1.23681 XP_010368374.1.97406 XP_011765751.1.29376 XP_011805660.1.43180 XP_011824709.1.47321 XP_011920276.1.92194 XP_014992319.1.72884 XP_016866833.1.92137 XP_017743769.1.44346 ENSPTRP00000031397 ENSPTRP00000031397 ENSP00000358853 ENSP00000358853 ENSPPYP00000018798 ENSP00000358853 gi|13899317|ref|NP_113657.1| ENSPPYP00000018798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]