SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|13929434|ref|NP_004267.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13929434|ref|NP_004267.2|
Domain Number 1 Region: 19-166
Classification Level Classification E-value
Superfamily EF-hand 6.55e-61
Family SCOPe 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|13929434|ref|NP_004267.2|
Sequence length 167
Comment calcium-binding protein 1 isoform 2 [Homo sapiens]
Sequence
MGNCVKYPLRNLSRKDRSLRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTE
MELIELSQQINMNLGGHVDFDDFVELMGPKLLAETADMIGVKELRDAFREFDTNGDGEIS
TSELREAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVDFEEFVRMMSR
Download sequence
Identical sequences NP_004267.2.87134 NP_004267.2.92137 gi|13929434|ref|NP_004267.2| ENSP00000288615 ENSP00000288615 CIRMMP38 2lan_A 2lap_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]