SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|139394668|ref|NP_055945.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|139394668|ref|NP_055945.2|
Domain Number 1 Region: 488-661
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.59e-49
Family Ypt/Rab-GAP domain of gyp1p 0.0028
Further Details:      
 
Domain Number 2 Region: 643-740
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.14e-19
Family Ypt/Rab-GAP domain of gyp1p 0.026
Further Details:      
 
Domain Number 3 Region: 808-944,1194-1231
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000454
Family Calmodulin-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|139394668|ref|NP_055945.2|
Sequence length 1266
Comment TBC1 domain family member 9 [Homo sapiens]
Sequence
MWVNPEEVLLANALWITERANPYFILQRRKGHAGDGGGGGGLAGLLVGTLDVVLDSSARV
APYRILYQTPDSLVYWTIACGGSRKEITEHWEWLEQNLLQTLSIFENENDITTFVRGKIQ
GIIAEYNKINDVKEDDDTEKFKEAIVKFHRLFGMPEEEKLVNYYSCSYWKGKVPRQGWMY
LSINHLCFYSFLMGREAKLVIRWVDITQLEKNATLLLPDVIKVSTRSSEHFFSVFLNINE
TFKLMEQLANIAMRQLLDNEGFEQDRSLPKLKRKSPKKVSALKRDLDARAKSERYRALFR
LPKDEKLDGHTDCTLWTPFNKMHILGQMFVSTNYICFTSKEENLCSLIIPLREVTIVEKA
DSSSVLPSPLSISTRNRMTFLFANLKDRDFLVQRISDFLQQTTSKIYSDKEFAGSYNSSD
DEVYSRPSSLVSSSPQRSTSSDADGERQFNLNGNSVPTATQTLMTMYRRRSPEEFNPKLA
KEFLKEQAWKIHFAEYGQGICMYRTEKTRELVLKGIPESMRGELWLLLSGAINEKATHPG
YYEDLVEKSMGKYNLATEEIERDLHRSLPEHPAFQNEMGIAALRRVLTAYAFRNPNIGYC
QAMNIVTSVLLLYAKEEEAFWLLVALCERMLPDYYNTRVVGALVDQGVFEELARDYVPQL
YDCMQDLGVISTISLSWFLTLFLSVMPFESAVVVVDCFFYEGIKVIFQLALAVLDANVDK
LLNCKDDGEAMTVLGRYLDSVTNKDSTLPPIPHLHSLLSDDVEPYPEVDIFRLIRTSYEK
FGTIRADLIEQMRFKQRLKVIQTLEDTTKRNVVRTIVTETSFTIDELEELYALFKAEHLT
SCYWGGSSNALDRHDPSLPYLEQYRIDFEQFKGMFALLFPWACGTHSDVLASRLFQLLDE
NGDSLINFREFVSGLSAACHGDLTEKLKLLYKMHVLPEPSSDQDEPDSAFEATQYFFEDI
TPECTHVVGLDSRSKQGADDGFVTVSLKPDKGKRANSQENRNYLRLWTPENKSKSKNAKD
LPKLNQGQFIELCKTMYNMFSEDPNEQELYHATAAVTSLLLEIGEVGKLFVAQPAKEGGS
GGSGPSCHQGIPGVLFPKKGPGQPYVVESVEPLPASLAPDSEEHSLGGQMEDIKLEDSSP
RDNGACSSMLISDDDTKDDSSMSSYSVLSAGSHEEDKLHCEDIGEDTVLVRSGQGTAALP
RSTSLDRDWAITFEQFLASLLTEPALVKYFDKPVCMMARITSAKNIRMMGKPLTSASDYE
ISAMSG
Download sequence
Identical sequences A0A0D9S105 A0A2J8XP32 A0A2K5WRS6 A0A2K6DL73 A0A2K6MH77 A0A2K6QKP7 K7BPQ8 Q6ZT07
ENSP00000411197 9544.ENSMMUP00000019988 9606.ENSP00000411197 NP_055945.2.87134 NP_055945.2.92137 XP_001139147.3.37143 XP_003820737.1.60992 XP_005556025.1.63531 XP_007998049.1.81039 XP_010354233.1.97406 XP_011759126.1.29376 XP_014994741.1.72884 XP_017729132.1.44346 ENSP00000411197 ENSMMUP00000019988 ENSP00000411197 ENSMMUP00000019988 gi|139394668|ref|NP_055945.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]