SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|14149694|ref|NP_056428.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14149694|ref|NP_056428.1|
Domain Number 1 Region: 58-251
Classification Level Classification E-value
Superfamily L domain-like 1.52e-30
Family Ngr ectodomain-like 0.0028
Further Details:      
 
Domain Number 2 Region: 258-351
Classification Level Classification E-value
Superfamily Immunoglobulin 5.32e-16
Family I set domains 0.013
Further Details:      
 
Domain Number 3 Region: 431-500
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000135
Family Fibronectin type III 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|14149694|ref|NP_056428.1|
Sequence length 623
Comment leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 1 [Homo sapiens]
Sequence
MRVALGMLWLLALAWPPQARGFCPSQCSCSLHIMGDGSKARTVVCNDPDMTLPPASIPPD
TSRLRLERTAIRRVPGEAFRPLGRLEQLWLPYNALSELNALMLRGLRRLRELRLPGNRLA
AFPWAALRDAPKLRLLDLQANRLSAVPAEAARFLENLTFLDLSSNQLMRLPQELIVSWAH
LETGIFPPGHHPRRVLGLQDNPWACDCRLYDLVHLLDGWAPNLAFIETELRCASPRSLAG
VAFSQLELRKCQGPELHPGVASIRSLLGGTALLRCGATGVPGPEMSWRRANGRPLNGTVH
QEVSSDGTSWTLLGLPAVSHLDSGDYICQAKNFLGASETVISLIVTEPPTSTEHSGSPGA
LWARTGGGGEAAAYNNKLVARHVPQIPKPAVLATGPSVPSTKEELTLEHFQMDALGELSD
GRAGPSEARMVRSVKVVGDTYHSVSLVWKAPQAKNTTAFSVLYAVFGQHSMRRVIVQPGK
TRVTITGLLPKTKYVACVCVQGLVPRKEQCVIFSTNEVVDAENTQQLINVVVISVAIVIA
LPLTLLVCCSALQKRCRKCFNKDSTEATVTYVNLERLGYSEDGLEELSRHSVSEADRLLS
ARSSVDFQAFGVKGGRRINEYFC
Download sequence
Identical sequences Q9P2V4
NP_056428.1.87134 NP_056428.1.92137 ENSP00000361177 9606.ENSP00000361177 ENSP00000361177 NYSGRC-IgSF-LRIT1_HUMAN ENSP00000361177 gi|14149694|ref|NP_056428.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]