SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|14161692|ref|NP_115706.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14161692|ref|NP_115706.1|
Domain Number 1 Region: 32-246
Classification Level Classification E-value
Superfamily EF-hand 1.54e-53
Family Penta-EF-hand proteins 0.000000677
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|14161692|ref|NP_115706.1|
Sequence length 248
Comment calpain small subunit 2 [Homo sapiens]
Sequence
MFLAKALLEGADRGLGEALGGLFGGGGQRREGGGRNIGGIVGGIVNFISEAAAAQYTPEP
PPTQQHFTSVEASESEEVRRFRQQFTQLAGPDMEVGATDLMNILNKVLSKHKDLKTDGFS
LDTCRSIVSVMDSDTTGKLGFEEFKYLWNNIKKWQCVYKQYDRDHSGSLGSSQLRGALQA
AGFQLNEQLYQMIVRRYANEDGDMDFNNFISCLVRLDAMFRAFKSLDRDRDGLIQVSIKE
WLQLTMYS
Download sequence
Identical sequences A0A2J8MWP7 Q96L46
ENSP00000400882 NP_115706.1.87134 NP_115706.1.92137 XP_003811526.1.60992 XP_004057709.1.27298 ENSP00000400882 gi|14161692|ref|NP_115706.1| ENSP00000400882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]