SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|14249340|ref|NP_116115.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14249340|ref|NP_116115.1|
Domain Number 1 Region: 290-610
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.15e-131
Family Mammalian PLC 0.000000033
Further Details:      
 
Domain Number 2 Region: 133-289
Classification Level Classification E-value
Superfamily EF-hand 3.49e-48
Family EF-hand modules in multidomain proteins 0.00042
Further Details:      
 
Domain Number 3 Region: 628-753
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.38e-30
Family PLC-like (P variant) 0.00014
Further Details:      
 
Domain Number 4 Region: 9-123
Classification Level Classification E-value
Superfamily PH domain-like 5.9e-27
Family Pleckstrin-homology domain (PH domain) 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|14249340|ref|NP_116115.1|
Sequence length 762
Comment 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta-4 [Homo sapiens]
Sequence
MASLLQDQLTTDQDLLLMQEGMPMRKVRSKSWKKLRYFRLQNDGMTVWHARQARGSAKPS
FSISDVETIRNGHDSELLRSLAEELPLEQGFTIVFHGRRSNLDLMANSVEEAQIWMRGLQ
LLVDLVTSMDHQERLDQWLSDWFQRGDKNQDGKMSFQEVQRLLHLMNVEMDQEYAFSLFQ
AADTSQSGTLEGEEFVQFYKALTKRAEVQELFESFSADGQKLTLLEFLDFLQEEQKERDC
TSELALELIDRYEPSDSGKLRHVLSMDGFLSYLCSKDGDIFNPACLPIYQDMTQPLNHYF
ICSSHNTYLVGDQLCGQSSVEGYIRALKRGCRCVEVDVWDGPSGEPVVYHGHTLTSRILF
KDVVATVAQYAFQTSDYPVILSLETHCSWEQQQTMARHLTEILGEQLLSTTLDGVLPTQL
PSPEELRRKILVKGKKLTLEEDLEYEEEEAEPELEESELALESQFETEPEPQEQNLQNKD
KKKKSKPILCPALSSLVIYLKSVSFRSFTHSKEHYHFYEISSFSETKAKRLIKEAGNEFV
QHNTWQLSRVYPSGLRTDSSNYNPQELWNAGCQMVAMNMQTAGLEMDICDGHFRQNGGCG
YVLKPDFLRDIQSSFHPEKPISPFKAQTLLIQVISGQQLPKVDKTKEGSIVDPLVKVQIF
GVRLDTARQETNYVENNGFNPYWGQTLCFRVLVPELAMLRFVVMDYDWKSRNDFIGQYTL
PWTCMQQGYRHIHLLSKDGISLRPASIFVYICIQEGLEGDES
Download sequence
Identical sequences Q9BRC7
ENSP00000388631 ENSP00000396942 ENSP00000388631 ENSP00000396942 gi|14249340|ref|NP_116115.1| NP_116115.1.87134 NP_116115.1.92137 9606.ENSP00000388631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]