SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|14249590|ref|NP_116247.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14249590|ref|NP_116247.1|
Domain Number 1 Region: 5-63
Classification Level Classification E-value
Superfamily HMG-box 0.0000000196
Family HMG-box 0.0056
Further Details:      
 
Weak hits

Sequence:  gi|14249590|ref|NP_116247.1|
Domain Number - Region: 167-254
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00117
Family Calponin-homology domain, CH-domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|14249590|ref|NP_116247.1|
Sequence length 434
Comment protein maelstrom homolog [Homo sapiens]
Sequence
MPNRKASRNAYYFFVQEKIPELRRRGLPVARVADAIPYCSSDWALLREEEKEKYAEMARE
WRAAQGKDPGPSEKQKPVFTPLRRPGMLVPKQNVSPPDMSALSLKGDQALLGGIFYFLNI
FSHGELPPHCEQRFLPCEIGCVKYSLQEGIMADFHSFINPGEIPRGFRFHCQAASDSSHK
IPISNFERGHNQATVLQNLYRFIHPNPGNWPPIYCKSDDRTRVNWCLKHMAKASEIRQDL
QLLTVEDLVVGIYQQKFLKEPSKTWIRSLLDVAMWDYSSNTRCKWHEENDILFCALAVCK
KIAYCISNSLATLFGIQLTEAHVPLQDYEASNSVTPKMVVLDAGRYQKLRVGSSGFSHFN
SSNEEQRSNTPIGDYPSRAKISGQNSSVRGRGITRLLESISNSSSNIHKFSNCDTSLSPY
MSQKDGYKSFSSLS
Download sequence
Identical sequences A0A140VJP0 Q96JY0
ENSP00000356846 NP_116247.1.87134 NP_116247.1.92137 ENSP00000356846 9606.ENSP00000356846 NYSGRC-14249590 ENSP00000356844 gi|14249590|ref|NP_116247.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]