SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|14251209|ref|NP_001279.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14251209|ref|NP_001279.2|
Domain Number 1 Region: 92-238
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.56e-38
Family Glutathione S-transferase (GST), C-terminal domain 0.0000000826
Further Details:      
 
Domain Number 2 Region: 22-90
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.9e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.0000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|14251209|ref|NP_001279.2|
Sequence length 241
Comment chloride intracellular channel protein 1 [Homo sapiens]
Sequence
MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCP
GGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKN
SNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNL
LPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKAL
K
Download sequence
Identical sequences G3R6T1 H2QSP1 O00299 Q5SRT3
ENSP00000364934 ENSP00000372896 ENSP00000391395 ENSP00000398056 ENSP00000400280 ENSP00000401292 ENSP00000406088 gi|14251209|ref|NP_001279.2| 400203 NP_001274522.1.87134 NP_001274522.1.92137 NP_001274523.1.87134 NP_001274523.1.92137 NP_001279.2.87134 NP_001279.2.92137 XP_004043733.2.27298 XP_004043734.2.27298 XP_008955145.1.60992 XP_018884430.1.27298 XP_518357.2.37143 ENSP00000364934 ENSP00000364935 ENSP00000364940 ENSP00000372896 ENSP00000372897 ENSP00000379229 ENSP00000382926 ENSP00000382931 ENSP00000391395 ENSP00000398056 ENSP00000400280 ENSP00000400532 ENSP00000401292 ENSP00000404037 ENSP00000404589 ENSP00000406088 ENSP00000406335 ENSP00000406968 ENSP00000407429 ENSP00000407791 ENSP00000408094 ENSP00000408357 ENSP00000409247 ENSP00000409979 ENSP00000410965 ENSP00000412217 ENSP00000413330 ENSP00000416211 ENSP00000477623 ENSP00000478930 ENSP00000479501 ENSP00000479808 ENSP00000480256 ENSP00000482255 ENSP00000484581 ENSPTRP00000030690 ENSP00000364934 ENSP00000364935 ENSP00000364940 ENSP00000372896 ENSP00000372897 ENSP00000379229 ENSP00000382926 ENSP00000382931 ENSP00000391395 ENSP00000398056 ENSP00000400280 ENSP00000400532 ENSP00000401292 ENSP00000404037 ENSP00000404589 ENSP00000406088 ENSP00000406335 ENSP00000406968 ENSP00000407429 ENSP00000407791 ENSP00000408094 ENSP00000408357 ENSP00000409247 ENSP00000409979 ENSP00000410965 ENSP00000412217 ENSP00000413330 ENSP00000416211 ENSPTRP00000030690 9598.ENSPTRP00000030690 9606.ENSP00000364934 9606.ENSP00000372896 9606.ENSP00000404589 9606.ENSP00000406335 9606.ENSP00000408094 9606.ENSP00000409247 9606.ENSP00000412217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]