SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|144953895|ref|NP_031387.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|144953895|ref|NP_031387.3|
Domain Number 1 Region: 527-751
Classification Level Classification E-value
Superfamily GFP-like 7.01e-85
Family Domain G2 of nidogen-1 0.000000661
Further Details:      
 
Domain Number 2 Region: 1107-1363
Classification Level Classification E-value
Superfamily YWTD domain 1.05e-41
Family YWTD domain 0.0000000934
Further Details:      
 
Domain Number 3 Region: 901-1007
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 9.29e-23
Family Thyroglobulin type-1 domain 0.00044
Further Details:      
 
Domain Number 4 Region: 1014-1084
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.88e-19
Family Thyroglobulin type-1 domain 0.001
Further Details:      
 
Domain Number 5 Region: 483-524,762-859
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000455
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 6 Region: 851-909
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000382
Family EGF-like domain of nidogen-1 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|144953895|ref|NP_031387.3|
Sequence length 1375
Comment nidogen-2 precursor [Homo sapiens]
Sequence
MEGDRVAGRPVLSSLPVLLLLPLLMLRAAALHPDELFPHGESWGDQLLQEGDDESSAVVK
LANPLHFYEARFSNLYVGTNGIISTQDFPRETQYVDYDFPTDFPAIAPFLADIDTSHGRG
RVLYREDTSPAVLGLAARYVRAGFPRSARFTPTHAFLATWEQVGAYEEVKRGALPSGELN
TFQAVLASDGSDSYALFLYPANGLQFLGTRPKESYNVQLQLPARVGFCRGEADDLKSEGP
YFSLTSTEQSVKNLYQLSNLGIPGVWAFHIGSTSPLDNVRPAAVGDLSAAHSSVPLGRSF
SHATALESDYNEDNLDYYDVNEEEAEYLPGEPEEALNGHSSIDVSFQSKVDTKPLEESST
LDPHTKEGTSLGEVGGPDLKGQVEPWDERETRSPAPPEVDRDSLAPSWETPPPYPENGSI
QPYPDGGPVPSEMDVPPAHPEEEIVLRSYPASGHTTPLSRGTYEVGLEDNIGSNTEVFTY
NAANKETCEHNHRQCSRHAFCTDYATGFCCHCQSKFYGNGKHCLPEGAPHRVNGKVSGHL
HVGHTPVHFTDVDLHAYIVGNDGRAYTAISHIPQPAAQALLPLTPIGGLFGWLFALEKPG
SENGFSLAGAAFTHDMEVTFYPGEETVRITQTAEGLDPENYLSIKTNIQGQVPYVSANFT
AHISPYKELYHYSDSTVTSTSSRDYSLTFGAINQTWSYRIHQNITYQVCRHAPRHPSFPT
TQQLNVDRVFALYNDEERVLRFAVTNQIGPVKEDSDPTPGNPCYDGSHMCDTTARCHPGT
GVDYTCECASGYQGDGRNCVDENECATGFHRCGPNSVCINLPGSYRCECRSGYEFADDRH
TCILITPPANPCEDGSHTCAPAGQARCVHHGGSTFSCACLPGYAGDGHQCTDVDECSENR
CHPAATCYNTPGSFSCRCQPGYYGDGFQCIPDSTSSLTPCEQQQRHAQAQYAYPGARFHI
PQCDEQGNFLPLQCHGSTGFCWCVDPDGHEVPGTQTPPGSTPPHCGPSPEPTQRPPTICE
RWRENLLEHYGGTPRDDQYVPQCDDLGHFIPLQCHGKSDFCWCVDKDGREVQGTRSQPGT
TPACIPTVAPPMVRPTPRPDVTPPSVGTFLLYTQGQQIGYLPLNGTRLQKDAAKTLLSLH
GSIIVGIDYDCRERMVYWTDVAGRTISRAGLELGAEPETIVNSGLISPEGLAIDHIRRTM
YWTDSVLDKIESALLDGSERKVLFYTDLVNPRAIAVDPIRGNLYWTDWNREAPKIETSSL
DGENRRILINTDIGLPNGLTFDPFSKLLCWADAGTKKLECTLPDGTGRRVIQNNLKYPFS
IVSYADHFYHTDWRRDGVVSVNKHSGQFTDEYLPEQRSHLYGITAVYPYCPTGRK
Download sequence
Identical sequences Q14112
gi|144953895|ref|NP_031387.3| ENSP00000216286 NP_031387.3.87134 NP_031387.3.92137 ENSP00000216286 9606.ENSP00000216286 ENSP00000216286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]