SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145275213|ref|NP_000496.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145275213|ref|NP_000496.2|
Domain Number 1 Region: 357-613
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.1e-79
Family Eukaryotic proteases 0.00013
Further Details:      
 
Domain Number 2 Region: 196-305
Classification Level Classification E-value
Superfamily Kringle-like 5.07e-33
Family Kringle modules 0.00035
Further Details:      
 
Domain Number 3 Region: 36-90
Classification Level Classification E-value
Superfamily Kringle-like 5.6e-20
Family Fibronectin type II module 0.0039
Further Details:      
 
Domain Number 4 Region: 96-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family EGF-type module 0.024
Further Details:      
 
Weak hits

Sequence:  gi|145275213|ref|NP_000496.2|
Domain Number - Region: 132-167
Classification Level Classification E-value
Superfamily FnI-like domain 0.0349
Family Fibronectin type I module 0.0084
Further Details:      
 
Domain Number - Region: 177-205
Classification Level Classification E-value
Superfamily EGF/Laminin 0.067
Family EGF-type module 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|145275213|ref|NP_000496.2|
Sequence length 615
Comment coagulation factor XII precursor [Homo sapiens]
Sequence
MRALLLLGFLLVSLESTLSIPPWEAPKEHKYKAEEHTVVLTVTGEPCHFPFQYHRQLYHK
CTHKGRPGPQPWCATTPNFDQDQRWGYCLEPKKVKDHCSKHSPCQKGGTCVNMPSGPHCL
CPQHLTGNHCQKEKCFEPQLLRFFHKNEIWYRTEQAAVARCQCKGPDAHCQRLASQACRT
NPCLHGGRCLEVEGHRLCHCPVGYTGAFCDVDTKASCYDGRGLSYRGLARTTLSGAPCQP
WASEATYRNVTAEQARNWGLGGHAFCRNPDNDIRPWCFVLNRDRLSWEYCDLAQCQTPTQ
AAPPTPVSPRLHVPLMPAQPAPPKPQPTTRTPPQSQTPGALPAKREQPPSLTRNGPLSCG
QRLRKSLSSMTRVVGGLVALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAP
EDLTVVLGQERRNHSCEPCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDADGSCALLSP
YVQPVCLPSGAARPSETTLCQVAGWGHQFEGAEEYASFLQEAQVPFLSLERCSAPDVHGS
SILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYT
DVAYYLAWIREHTVS
Download sequence
Identical sequences P00748
gi|145275213|ref|NP_000496.2| NP_000496.2.87134 NP_000496.2.92137 ENSP00000253496 ENSP00000253496 9606.ENSP00000253496 ENSP00000253496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]