SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145580582|ref|NP_775839.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145580582|ref|NP_775839.3|
Domain Number 1 Region: 314-400,822-906
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000339
Family Fibronectin type III 0.0062
Further Details:      
 
Domain Number 2 Region: 113-157
Classification Level Classification E-value
Superfamily Elafin-like 0.000000222
Family Elafin-like 0.0021
Further Details:      
 
Domain Number 3 Region: 501-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000033
Family EGF-type module 0.021
Further Details:      
 
Domain Number 4 Region: 261-296
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000737
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  gi|145580582|ref|NP_775839.3|
Domain Number - Region: 1018-1057
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000234
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 391-475
Classification Level Classification E-value
Superfamily SEA domain 0.000366
Family SEA domain 0.012
Further Details:      
 
Domain Number - Region: 922-961
Classification Level Classification E-value
Superfamily SEA domain 0.0693
Family SEA domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|145580582|ref|NP_775839.3|
Sequence length 1446
Comment uromodulin-like 1 isoform 2 precursor [Homo sapiens]
Sequence
MLRTSGLALLALVSAVGPSQASGFTEKGLSLLGYQLCSHRVTHTVQKVEAVQTSYTSYVS
CGGWIPWRRCPKMVYRTQYLVVEVPESRNVTDCCEGYEQLGLYCVLPLNQSGQFTSRPGA
CPAEGPEPSTSPCSLDIDCPGLEKCCPWSGGRYCMAPAPQAPERDPVGSWYNVTILVKMD
FKELQQVDPRLLNHMRLLHSLVTSALQPMASTVHHLHSAPGNASTTVSRLLLGLPRPLPV
ADVSTLLGDIAKRVYEVISVQVQDVNECFYEELNACSGRELCANLEGSYWCVCHQEAPAT
SPRKLNLEWEDCPPVSDYVVLNVTSDSFQVSWRLNSTQNHTFHVRVYRGMELLRSARTQS
QALAVAGLEAGVLYRVKTSYQGCGADVSTTLTIKTNAQVFEVTIKIVNHNLTEKLLNRSS
VEYQDFSRQLLHEVESSFPPVVSDLYRSGKLRMQIVSLQAGSVVVRLKLTVQDPGFPMGI
STLAPILQPLLASTVFQIDRQGTRVQDWDECVDSAEHDCSPAAWCINLEGSYTCQCRTTR
DATPSRAGRACEGDLVSPTGGGLSAATGVTVPGLGTGTAALGLENFTLSPSPGYPQGTPA
AGQAWTPEPSPRRGGSNVVGYDRNNTGKGVEQEVPSTAPGLGMDQGSPSQVNPSQGSPSQ
GSLRQESTSQASPSQRSTSQGSPSQVNPSQRSTSHANSSQGSPSQGSPSQESPSQGSTSQ
ASPSHRNTIGVIGTTSSPKATGSTHSFPPGATDGPLALPGQLQGNSIMEPPSWPSPTEDP
TGHFLWHATRSTRETLLNPTWLRNEDSGPSGSVDLPLTSTLTALKTPACVPVSIGRIMVS
NVTSTGFHLAWEADLAMDSTFQLTLTSMWSPAVVLETWNTSVTLSGLEPGVLHLVEIMAK
ACGKEGARAHLKVRTAARKLIGKVRIKNVRYSESFRNASSQEYRDFLELFFRMVRGSLPA
TMCQHMDAGGVRMEVVSVTNGSIVVEFHLLIIADVDVQEVSAAFLTAFQTVPLLEVIRGD
TFIQDYDECERKEDDCVPGTSCRNTLGSFTCSCEGGAPDFPVEYSERPCEGDSPGNETWA
TSPERPLTTAGTKAAFVQGTSPTPQGLPQRLNLTGAVRVLCEIEKVVVAIQKRFLQQESI
PESSLYLSHPSCNVSHSNGTHVLLEAGWSECGTLMQSNMTNTVVRTTLRNDLSQEGIIHH
LKILSPIYCAFQNDLLTSSGFTLEWGVYTIIEDLHGAGNFVTEMQLFIGDSPIPQNYSVS
ASDDVRIEVGLYRQKSNLKVVLTECWATPSSNARDPITFSFINNSCPVPNTYTNVIENGN
SNKAQFKLRIFSFINDSIVYLHCKLRVCMESPGATCKINCNNFRLLQNSETSATHQMSWG
PLIRSEGEPPHAEAGLGAGYVVLIVVAIFVLVAGTATLLIVRYQRMNGRYNFKIQSNNFS
YQVFYE
Download sequence
Identical sequences NYSGRC-145580582 gi|145580582|ref|NP_775839.3| NP_775839.3.87134 NP_775839.3.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]