SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145580584|ref|NP_001004416.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145580584|ref|NP_001004416.2|
Domain Number 1 Region: 314-400,694-778
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000302
Family Fibronectin type III 0.0062
Further Details:      
 
Domain Number 2 Region: 113-157
Classification Level Classification E-value
Superfamily Elafin-like 0.00000017
Family Elafin-like 0.0021
Further Details:      
 
Domain Number 3 Region: 509-551,896-928
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000361
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 4 Region: 261-296
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000727
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  gi|145580584|ref|NP_001004416.2|
Domain Number - Region: 391-475
Classification Level Classification E-value
Superfamily SEA domain 0.000327
Family SEA domain 0.012
Further Details:      
 
Domain Number - Region: 794-833
Classification Level Classification E-value
Superfamily SEA domain 0.0628
Family SEA domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|145580584|ref|NP_001004416.2|
Sequence length 1318
Comment uromodulin-like 1 isoform 1 precursor [Homo sapiens]
Sequence
MLRTSGLALLALVSAVGPSQASGFTEKGLSLLGYQLCSHRVTHTVQKVEAVQTSYTSYVS
CGGWIPWRRCPKMVYRTQYLVVEVPESRNVTDCCEGYEQLGLYCVLPLNQSGQFTSRPGA
CPAEGPEPSTSPCSLDIDCPGLEKCCPWSGGRYCMAPAPQAPERDPVGSWYNVTILVKMD
FKELQQVDPRLLNHMRLLHSLVTSALQPMASTVHHLHSAPGNASTTVSRLLLGLPRPLPV
ADVSTLLGDIAKRVYEVISVQVQDVNECFYEELNACSGRELCANLEGSYWCVCHQEAPAT
SPRKLNLEWEDCPPVSDYVVLNVTSDSFQVSWRLNSTQNHTFHVRVYRGMELLRSARTQS
QALAVAGLEAGVLYRVKTSYQGCGADVSTTLTIKTNAQVFEVTIKIVNHNLTEKLLNRSS
VEYQDFSRQLLHEVESSFPPVVSDLYRSGKLRMQIVSLQAGSVVVRLKLTVQDPGFPMGI
STLAPILQPLLASTVFQIDRQGTRVQDWDECVDSAEHDCSPAAWCINLEGSYTCQCRTTR
DATPSRAGRACEGDLVSPTGGGLSAATGVTVPGLGTGTAALGLENFTLSPSPGYPQGTPA
AGQAWTPEPSPRRGGSNVVGYDRNNTGKGVEQELQGNSIMEPPSWPSPTEDPTGHFLWHA
TRSTRETLLNPTWLRNEDSGPSGSVDLPLTSTLTALKTPACVPVSIGRIMVSNVTSTGFH
LAWEADLAMDSTFQLTLTSMWSPAVVLETWNTSVTLSGLEPGVLHLVEIMAKACGKEGAR
AHLKVRTAARKLIGKVRIKNVRYSESFRNASSQEYRDFLELFFRMVRGSLPATMCQHMDA
GGVRMEVVSVTNGSIVVEFHLLIIADVDVQEVSAAFLTAFQTVPLLEVIRGDTFIQDYDE
CERKEDDCVPGTSCRNTLGSFTCSCEGGAPDFPVEYSERPCEGDSPGNETWATSPERPLT
TAGTKAAFVQGTSPTPQGLPQRLNLTGAVRVLCEIEKVVVAIQKRFLQQESIPESSLYLS
HPSCNVSHSNGTHVLLEAGWSECGTLMQSNMTNTVVRTTLRNDLSQEGIIHHLKILSPIY
CAFQNDLLTSSGFTLEWGVYTIIEDLHGAGNFVTEMQLFIGDSPIPQNYSVSASDDVRIE
VGLYRQKSNLKVVLTECWATPSSNARDPITFSFINNSCPVPNTYTNVIENGNSNKAQFKL
RIFSFINDSIVYLHCKLRVCMESPGATCKINCNNFRLLQNSETSATHQMSWGPLIRSEGE
PPHAEAGLGAGYVVLIVVAIFVLVAGTATLLIVRYQRMNGRYNFKIQSNNFSYQVFYE
Download sequence
Identical sequences NP_001004416.2.87134 NP_001004416.2.92137 gi|145580584|ref|NP_001004416.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]