SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145580592|ref|NP_689805.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145580592|ref|NP_689805.3|
Domain Number 1 Region: 60-189
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000432
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 2 Region: 214-327
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000275
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 3 Region: 601-743
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000648
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 4 Region: 436-553
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000288
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 5 Region: 514-607
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000384
Family Spectrin repeat 0.018
Further Details:      
 
Weak hits

Sequence:  gi|145580592|ref|NP_689805.3|
Domain Number - Region: 786-822
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.0961
Family SCAN domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|145580592|ref|NP_689805.3|
Sequence length 975
Comment nesprin-3 [Homo sapiens]
Sequence
MTQQPQDDFDRSVEDAQAWMKAVQDQLQVNDNTQGPRAALEARLWETEKICQLEPEGRVR
VDLVLRMAEALLACCPGDQKPGILARLKDIKAQWEETVTYMTHCHSRIEWVWLHWSEYLL
ARDEFYRWFQKMMVTLEPHIELQLGLKEKQWQLSHAQVLLHNVDNQAVLLDRLLEEAASL
FNRIGDPSVDEDAQKRMKAEYDAVKAKAQKRVDLLEQVAREHEEYQAGVDEFQLWLKAVV
EKVNGCLGRNCKLPITQRLSTLQDIAKDFPRGEESLETLEEQSAGVIRNTSPLGAEKITG
ELEEMRKVLEKLRALWEEEEERLRGLLRSRGAWEQQIKQLEAELSEFRMVLQRLAQEGLQ
PAAKAGTEDELVAHWRRYSATRAALASEEPRVDRLQAQLKELIVFPHNLKPLSDSVIATI
QEYQSLKVKSARLRNAAAVELWQHFQRPLQDLQLWKALAQRLLEVTASLPDLPSLHTFLP
QIEAALMESSRLKELLTMLQLKKDLLIGIFGQERATALLEQVAGSMRDRDLLHNSLLQRK
SKLQSLLAQHKDFGAAFEPLQRKLLDLQVRVQAEKGLQRDLPGKQAQLSRLQGLQEEGLD
LGAQMEAARPLVQENPNHQHKMDQLSSDFQALQRSLEDLVDRCRQSVQEHCTFSHQLLEL
RQWIVVTTQKLEAHRGEAGPGDAESQEAEFERLVAEFPEKEAQLSLVEAQGWLVMEKSSP
EGAAVVQEELRELAESWRALRLLEESLLSLIRNWHLQRMEVDSGKKMVFTNNIPKSGFLI
NPMDPIPRHRRRANLLQEEEGSHEDFSQLLRNFGQWLQVENSKLVRIIAMRTSTAEDLRT
RKSKLQELEARVPEGQHLFENLLRLGPARGTSDELEDLRYQWMLYKSKLKDSGHLLTQSS
PGEPTGFQKTRRWRGLGSLFRRACCVALPLQLLLLLFLLLLFLLPIREEDRSCTLANNFA
RSFTLMLRYNGPPPT
Download sequence
Identical sequences Q6ZMZ3
NP_689805.3.87134 NP_689805.3.92137 XP_005267434.1.92137 XP_006720126.1.92137 9606.ENSP00000334308 ENSP00000334308 NYSGRC-145580592 ENSP00000334308 gi|145580592|ref|NP_689805.3| ENSP00000334308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]