SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|14574566|ref|NP_116573.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14574566|ref|NP_116573.1|
Domain Number 1 Region: 2-57
Classification Level Classification E-value
Superfamily EF-hand 0.000000000504
Family Calmodulin-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|14574566|ref|NP_116573.1|
Sequence length 93
Comment allograft inflammatory factor 1 isoform 1 [Homo sapiens]
Sequence
MEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKR
SAILKMILMYEEKAREKEKPTGPPAKKAISELP
Download sequence
Identical sequences A0A2J8NXS1 A0A2J8R4S6 I3WTX1
gi|14574566|ref|NP_116573.1| NP_001305899.1.87134 NP_001305899.1.92137 NP_116573.1.87134 NP_116573.1.92137 XP_008955191.2.60992 XP_009239931.1.23681 XP_011767200.1.29376 XP_011767201.1.29376 XP_011800082.1.43180 XP_011855868.1.47321 XP_012358543.1.23891 XP_014200789.1.60992 XP_016810619.1.37143 XP_018884599.1.27298 ENSP00000365217 ENSP00000372965 ENSP00000399621 ENSP00000399901 ENSP00000401433 ENSP00000413709 ENSP00000447578 ENSP00000365217 ENSP00000372965 ENSP00000399621 ENSP00000399901 ENSP00000401433 ENSP00000413709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]