SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|147906122|ref|NP_001091091.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147906122|ref|NP_001091091.1|
Domain Number 1 Region: 15-107
Classification Level Classification E-value
Superfamily EF-hand 1.53e-21
Family Parvalbumin 0.0000547
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|147906122|ref|NP_001091091.1|
Sequence length 109
Comment oncomodulin-1 [Homo sapiens]
Sequence
MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSANQVKDVFRFIDNDQSGYLD
EEELKFFLQKFESGARELTESETKSLMAAADNDGDGKIGAEEFQEMVHS
Download sequence
Identical sequences P0CE72
gi|147906122|ref|NP_001091091.1| 1ttx_A ENSP00000242104 ENSP00000401365 ENSP00000242104 ENSP00000401365 000156503|e1ttxA1|108.1.1.43|A:1-109 cath|current|1ttxA00/1-109 d1ttxa_ ENSP00000242104 NP_001091091.1.87134 NP_001091091.1.92137 XP_011513787.1.92137 9606.ENSP00000242104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]