SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148277065|ref|NP_003321.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148277065|ref|NP_003321.3|
Domain Number 1 Region: 62-442
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.75e-46
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000000857
Further Details:      
 
Domain Number 2 Region: 419-550
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.89e-33
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000158
Further Details:      
 
Weak hits

Sequence:  gi|148277065|ref|NP_003321.3|
Domain Number - Region: 5-52
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00626
Family Thioltransferase 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148277065|ref|NP_003321.3|
Sequence length 551
Comment thioredoxin reductase 1, cytoplasmic isoform 1 [Homo sapiens]
Sequence
MSCEDGRALEGTLSELAAETDLPVVFVKQRKIGGHGPTLKAYQEGRLQKLLKMNGPEDLP
KSYDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKK
LMHQAALLGQALQDSRNYGWKVEETVKHDWDRMIEAVQNHIGSLNWGYRVALREKKVVYE
NAYGQFIGPHRIKATNNKGKEKIYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPY
CPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFI
RQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVK
INEKTGKIPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQAGRLLAQRLYAGSTVKCDYE
NVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICN
TKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRS
GASILQAGCUG
Download sequence
Identical sequences gi|148277065|ref|NP_003321.3| ENSP00000435929 ENSP00000435929 NP_003321.3.87134 NP_003321.3.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]