SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148596959|ref|NP_115709.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|148596959|ref|NP_115709.3|
Domain Number - Region: 16-112
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000359
Family Glutathione peroxidase-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148596959|ref|NP_115709.3|
Sequence length 229
Comment peroxiredoxin (PRX)-like 2 activated in M-CSF stimulated monocytes precursor [Homo sapiens]
Sequence
MSFLQDPSFFTMGMWSIGAGALGAAALALLLANTDVFLSKPQKAALEYLEDIDLKTLEKE
PRTFKAKELWEKNGAVIMAVRRPGCFLCREEAADLSSLKSMLDQLGVPLYAVVKEHIRTE
VKDFQPYFKGEIFLDEKKKFYGPQRRKMMFMGFIRLGVWYNFFRAWNGGFSGNLEGEGFI
LGGVFVVGSGKQGILLEHREKEFGDKVNLLSVLEAAKMIKPQTLASEKK
Download sequence
Identical sequences G3RBQ5 Q9BRX8
ENSP00000361254 ENSP00000361261 ENSP00000361262 9606.ENSP00000361254 ENSP00000361254 ENSP00000361254 ENSP00000361261 ENSP00000361262 ENSP00000478152 ENSP00000482445 gi|148596959|ref|NP_115709.3| NP_001230707.1.87134 NP_001230707.1.92137 NP_001230708.1.87134 NP_001230708.1.92137 NP_001230709.1.87134 NP_001230709.1.92137 NP_115709.3.87134 NP_115709.3.92137 XP_011538567.1.92137 XP_011538568.1.92137 XP_018890794.1.27298 XP_018890795.1.27298 XP_018890796.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]