SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148727319|ref|NP_001091999.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148727319|ref|NP_001091999.1|
Domain Number 1 Region: 417-551
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.9e-28
Family Thioltransferase 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148727319|ref|NP_001091999.1|
Sequence length 553
Comment thioredoxin domain-containing protein 2 isoform 2 [Homo sapiens]
Sequence
MDVDKELGMESVKAGASGKPEMRLGTQEETSEGDANESSLLVLSSNVPLLALEFLEIAQA
KEKAFLPMVSHTFHMRTEESDASQEGDDLPKSSANTSHPKQDDSPKSSEETIQPKEGDIP
KAPEETIQSKKEDLPKSSEKAIQPKESNIPKSSAKPIQPKLGNIPKASVKPSQPKEGDIP
KAPEETIQSKKEDLPKSSEEAIQPKEGDIPKSSAKPIQPKLGNIAKTSVKPSQPKESDIP
KSPEETIQPKEGDIPKSSAKPIQPKLGNIPKASVKPSQPKEGDISKSPEEAIQPKEGDLP
KSLEEAIQPKEGDIPKSPEEAIQPKEGDIPKSLEEAIQPKEGDIPKSPEETIQPKKGDIP
KSPEEAIQPKEGDIPKSPKQAIQPKEGDIPKSLEEAIPPKEIDIPKSPEETIQPKEDDSP
KSLEEATPSKEGDILKPEEETMEFPEGDKVKVILSKEDFEASLKEAGERLVAVDFSATWC
GPCRTIRPFFHALSVKHEDVVFLEVDADNCEEVVRECAIMCVPTFQFYKKEEKVDELCGA
LKEKLEAVIAELK
Download sequence
Identical sequences A0A140VJY8 Q86VQ3
ENSP00000304908 NP_001091999.1.87134 NP_001091999.1.92137 9606.ENSP00000304908 gi|148727319|ref|NP_001091999.1| ENSP00000304908 ENSP00000304908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]